A5HJM1 · IL7RA_CALJA
- ProteinInterleukin-7 receptor subunit alpha
- GeneIL7R
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids459 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP) (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | external side of plasma membrane | |
Molecular Function | cytokine receptor activity | |
Biological Process | hemopoiesis | |
Biological Process | positive regulation of receptor signaling pathway via JAK-STAT |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameInterleukin-7 receptor subunit alpha
- Short namesIL-7 receptor subunit alpha; IL-7R subunit alpha; IL-7R-alpha; IL-7RA
- CD Antigen Name
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Platyrrhini > Cebidae > Callitrichinae > Callithrix > Callithrix
Accessions
- Primary accessionA5HJM1
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type I membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 21-241 | Extracellular | ||||
Sequence: ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVRCLNFRKLQEIYLIETKKFLLIGNSNICVKAGEKSLTCKNVNVATIVKPEAPFDLSVIYREGANDFLVTFNTSHLQKKYVKVLMHDVAYRHEKDENNWMHVNLSSTKLTLLQRKLQPKATYEIKVRSIPGDYFKGFWSEWSPSYYFRTPEINNHSGETNPT | ||||||
Transmembrane | 242-262 | Helical | ||||
Sequence: LLTISILSVLSVVLLVILACV | ||||||
Topological domain | 263-459 | Cytoplasmic | ||||
Sequence: LWKKRIKPIIWPSLPDHKKTLEHLCKKPSKNLIVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTVPPQLEESETQRPGGDVQSPSWPSENVVTTPETFGRDSPLRCLAGNVSAHDAPILSSSRSLDCRESATNGPHVNQDLLLSLGTTNSTLPPSFPPQSRILTLNPVAQGQPILTFLGSNKEEAYVTMSSFCQKR |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MTILGTTFGVFFSLLQVVSG | ||||||
Chain | PRO_0000369415 | 21-459 | Interleukin-7 receptor subunit alpha | |||
Sequence: ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVRCLNFRKLQEIYLIETKKFLLIGNSNICVKAGEKSLTCKNVNVATIVKPEAPFDLSVIYREGANDFLVTFNTSHLQKKYVKVLMHDVAYRHEKDENNWMHVNLSSTKLTLLQRKLQPKATYEIKVRSIPGDYFKGFWSEWSPSYYFRTPEINNHSGETNPTLLTISILSVLSVVLLVILACVLWKKRIKPIIWPSLPDHKKTLEHLCKKPSKNLIVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTVPPQLEESETQRPGGDVQSPSWPSENVVTTPETFGRDSPLRCLAGNVSAHDAPILSSSRSLDCRESATNGPHVNQDLLLSLGTTNSTLPPSFPPQSRILTLNPVAQGQPILTFLGSNKEEAYVTMSSFCQKR | ||||||
Disulfide bond | 42↔57 | |||||
Sequence: CYSQLEVNGSQHSLTC | ||||||
Glycosylation | 49 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 65 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 74↔82 | |||||
Sequence: CGALVEVRC | ||||||
Disulfide bond | 108↔118 | |||||
Sequence: CVKAGEKSLTC | ||||||
Glycosylation | 182 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Modified residue | 282 | Phosphothreonine; by PKC | ||||
Sequence: T |
Post-translational modification
N-glycosylated IL-7Ralpha binds IL7 300-fold more tightly than the unglycosylated form.
Keywords
- PTM
PTM databases
Expression
Gene expression databases
Interaction
Subunit
The IL7 receptor is a heterodimer of IL7R and IL2RG. The TSLP receptor is a heterodimer of CRLF2 and IL7R. Interacts with CD53.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, motif, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 131-231 | Fibronectin type-III | ||||
Sequence: APFDLSVIYREGANDFLVTFNTSHLQKKYVKVLMHDVAYRHEKDENNWMHVNLSSTKLTLLQRKLQPKATYEIKVRSIPGDYFKGFWSEWSPSYYFRTPEI | ||||||
Motif | 217-221 | WSXWS motif | ||||
Sequence: WSEWS | ||||||
Motif | 272-280 | Box 1 motif | ||||
Sequence: IWPSLPDHK | ||||||
Region | 327-357 | Disordered | ||||
Sequence: TVPPQLEESETQRPGGDVQSPSWPSENVVTT | ||||||
Compositional bias | 330-357 | Polar residues | ||||
Sequence: PQLEESETQRPGGDVQSPSWPSENVVTT |
Domain
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.
Sequence similarities
Belongs to the type I cytokine receptor family. Type 4 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length459
- Mass (Da)51,456
- Last updated2007-06-12 v1
- Checksum37541A485D1D6583
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 330-357 | Polar residues | ||||
Sequence: PQLEESETQRPGGDVQSPSWPSENVVTT |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
EF534213 EMBL· GenBank· DDBJ | ABQ09497.1 EMBL· GenBank· DDBJ | mRNA |