A4QP16 · ADN2A_DANRE
- ProteinActivity-dependent neuroprotective protein 2a
- Geneadnp2a
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids962 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
May be involved in transcriptional regulation (PubMed:23071114).
Required for progression through late erythroid differentiation (PubMed:23071114).
May be involved in vasculogenesis (PubMed:23071114).
Required for progression through late erythroid differentiation (PubMed:23071114).
May be involved in vasculogenesis (PubMed:23071114).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 795-854 | Homeobox | ||||
Sequence: PMGMERTSFEDRKDFLSQYFHRKPYVTKTEIELLASRLWINKADVKAHFNSKLTKCLKAI |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | metal ion binding | |
Biological Process | erythrocyte maturation | |
Biological Process | regulation of gene expression |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameActivity-dependent neuroprotective protein 2a
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionA4QP16
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Morpholino knockdown has no effect on overall morphology, and at the onset of blood circulation at 24 hours post-fertilization (hpf), blood cells are present, however between 33 and 48 hpf, blood cells are absent, and embryos develop cardiac edema (PubMed:23071114).
Hemoglobin undetectable (PubMed:23071114).
Some embryos recovered blood circulation at day 4 after knockdown, whereas others became severely edematous at day 4-5 and died by about 7 days (PubMed:23071114).
At 28 and 48 hpf, expression of band3 almost abolished; embryonic alpha-globin1 also significantly reduced at 28 hpf (PubMed:23071114).
Hemoglobin undetectable (PubMed:23071114).
Some embryos recovered blood circulation at day 4 after knockdown, whereas others became severely edematous at day 4-5 and died by about 7 days (PubMed:23071114).
At 28 and 48 hpf, expression of band3 almost abolished; embryonic alpha-globin1 also significantly reduced at 28 hpf (PubMed:23071114).
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000456968 | 1-962 | Activity-dependent neuroprotective protein 2a | |||
Sequence: MYQIPVKNLTKLRRPRKRVKSILCDIGMQQCQDMLETYKCFDAGDASFDNTEWDDFTDGHVGKKKKKYPYRSQSLCCSLCWYSSRSVPTFRSHIHRCHWKNLDGACLLMCPYCPFVSSPKVTEQHIQFFHMLPSRAHQSHPSHTLAHTPKTISVTVSADAADDRYTCATCGYHDSLLYVMKKHVLVNHFATLLDRYFGLGSESAPMAGPQIRDGTPVKYHCKLCKLPAETIEHLLYHILSSEKHKELHWQIMPCIIEKECMNQMVGLQNLLNLAPKSMQPVTLFARPNYMPQQTQQTNGNGTVLLAGPSNAAALFCSPGAGQMFLSPQTQALLSGTTVAALQNAPHPQSPGGMSQVLPTSPVVKPLNMVMPNMPQNTPKTLPLTMTVPRLPPPQQGPQVLLPPGVQVNLPGEMGVHSPFLVTQGLQLNQSVPRAPLITSQSVRFIPTGNKVNGVPTYTLAPVQVTVPVHGGPPQMVLAQNQISQPPNSAVVTPGLMPPVQRAMNKNSRPNELAVQAPFLKKHDNQTVKCLRCKILLTEQGIFQHLLHGLKCLFCPQMFYSFKQIMEHSKKEHSLKVKDNRLYIKEQFSLDCDDEGNLIFSTFNLNTDVPKDLLDNRELNLALVTSTKDKIYIKMYPDKAEYTTMLKSAPNACPFCQVKLQNPEDYELHLQTKHHIVPTIHAILKTPAYKCIYCFGVYTEKSTPKTISIHVQRCRCAPKAVKEAERKLNPDTSESHDGDVCSSVQMPASEVTFQGAPEFPKPKKEAVTPRNRRRNTKASKTGTLVPETPVTLVLEPMGMERTSFEDRKDFLSQYFHRKPYVTKTEIELLASRLWINKADVKAHFNSKLTKCLKAIQKKRVCVRLGFKMIEVNKLKHNLFIPEVKPVKRKDPNEVNLSSLVPGVTVKTEQVDATTQHPLFIPEVPVTIKKEEEVCEIDHGFIIQEVTVKQEEVDEMEDALCTNG |
Proteomic databases
Expression
Developmental stage
Expressed from the 1-cell stage, before the onset of zygotic expression, then, during gastrulation, at 6 hours post-fertilization (hpf), expression is absent, and at 11-12 hpf, coincident with segmentation, expression returns until 72 hpf.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for zinc finger, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Zinc finger | 75-98 | C2H2-type 1 | ||||
Sequence: LCCSLCWYSSRSVPTFRSHIHRCH | ||||||
Zinc finger | 108-130 | C2H2-type 2; degenerate | ||||
Sequence: LMCPYCPFVSSPKVTEQHIQFFH | ||||||
Zinc finger | 165-188 | C2H2-type 3; degenerate | ||||
Sequence: YTCATCGYHDSLLYVMKKHVLVNH | ||||||
Zinc finger | 219-244 | C2H2-type 4 | ||||
Sequence: YHCKLCKLPAETIEHLLYHILSSEKH | ||||||
Zinc finger | 527-547 | C2H2-type 5; degenerate | ||||
Sequence: VKCLRCKILLTEQGIFQHLLH | ||||||
Zinc finger | 549-572 | C2H2-type 6 | ||||
Sequence: LKCLFCPQMFYSFKQIMEHSKKEH | ||||||
Zinc finger | 650-673 | C2H2-type 7 | ||||
Sequence: NACPFCQVKLQNPEDYELHLQTKH | ||||||
Zinc finger | 688-712 | C2H2-type 8; degenerate | ||||
Sequence: YKCIYCFGVYTEKSTPKTISIHVQR | ||||||
Region | 753-781 | Disordered | ||||
Sequence: QGAPEFPKPKKEAVTPRNRRRNTKASKTG |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length962
- Mass (Da)108,104
- Last updated2007-05-15 v1
- Checksum8EFC023C8D472017
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 290 | in Ref. 1; CR391941 | ||||
Sequence: M → I | ||||||
Sequence conflict | 416 | in Ref. 1; CR391941 | ||||
Sequence: H → R | ||||||
Sequence conflict | 444 | in Ref. 1; CR391941 | ||||
Sequence: F → L | ||||||
Sequence conflict | 720 | in Ref. 1; CR391941 | ||||
Sequence: V → I | ||||||
Sequence conflict | 783 | in Ref. 1; CR391941 | ||||
Sequence: L → P | ||||||
Sequence conflict | 890 | in Ref. 1; CR391941 | ||||
Sequence: P → Q | ||||||
Sequence conflict | 938 | in Ref. 1; CR391941 | ||||
Sequence: G → S |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CR391941 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC139614 EMBL· GenBank· DDBJ | AAI39615.1 EMBL· GenBank· DDBJ | mRNA |