A4IFH6 · PPLA_BOVIN
- ProteinCardiac phospholamban
- GenePLN
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca2+. Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation. Controls intracellular Ca2+ levels in elongated spermatids. May play a role in germ cell differentiation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | membrane | |
Cellular Component | mitochondrial membrane | |
Cellular Component | sarcoplasmic reticulum | |
Cellular Component | sarcoplasmic reticulum membrane | |
Molecular Function | ATPase inhibitor activity | |
Molecular Function | protein homodimerization activity | |
Biological Process | acrosome assembly | |
Biological Process | intracellular calcium ion homeostasis | |
Biological Process | negative regulation of ATPase-coupled calcium transmembrane transporter activity | |
Biological Process | negative regulation of calcium ion import into sarcoplasmic reticulum | |
Biological Process | negative regulation of heart rate |
Names & Taxonomy
Protein names
- Recommended nameCardiac phospholamban
- Short namesPLB
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Ruminantia > Pecora > Bovidae > Bovinae > Bos
Accessions
- Primary accessionA4IFH6
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Single-pass membrane protein
Sarcoplasmic reticulum membrane ; Single-pass membrane protein
Mitochondrion membrane ; Single-pass membrane protein
Membrane ; Single-pass membrane protein
Note: Colocalizes with HAX1 at the endoplasmic reticulum. Colocalizes with DMPK a the sarcoplasmic reticulum.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-30 | Cytoplasmic | ||||
Sequence: MDKVQYLTRSAIRRASTIEMPQQARQNLQN | ||||||
Transmembrane | 31-51 | Helical | ||||
Sequence: LFINFCLISICLLLICIIVML |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for modified residue, chain, lipidation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 1 | N-acetylmethionine | ||||
Sequence: M | ||||||
Chain | PRO_0000353186 | 1-52 | Cardiac phospholamban | |||
Sequence: MDKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLISICLLLICIIVMLL | ||||||
Modified residue | 16 | Phosphoserine; by PKA and DMPK | ||||
Sequence: S | ||||||
Modified residue | 17 | Phosphothreonine; by CaMK2 | ||||
Sequence: T | ||||||
Lipidation | 36 | S-palmitoyl cysteine | ||||
Sequence: C |
Post-translational modification
Phosphorylation by PKA abolishes the inhibition of ATP2A2-mediated calcium uptake. Phosphorylated at Thr-17 by CaMK2, and in response to beta-adrenergic stimulation. Phosphorylation by DMPK may stimulate sarcoplasmic reticulum calcium uptake in cardiomyocytes (By similarity).
Palmitoylated by ZDHHC16, promoting formation of the homopentamer.
In elongated spermatids, proteolytically cleaved by SPPL2C which modulates intracellular Ca2+ homeostasis.
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Homopentamer. Interacts with HAX1. Interact with ATP2A2; the inhibition decreases ATP2A2 Ca2+ affinity. Interacts with VMP1; VMP1 competes with PLN and SLN to prevent them from forming an inhibitory complex with ATP2A2. Interacts with S100A1 in a Ca2+-dependent manner.
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length52
- Mass (Da)6,054
- Last updated2007-05-01 v1
- Checksum076361D9ADDC87D3
Mass Spectrometry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC134584 EMBL· GenBank· DDBJ | AAI34585.1 EMBL· GenBank· DDBJ | mRNA |