A2Y953 · ANM10_ORYSI
- ProteinProtein arginine N-methyltransferase PRMT10
- GenePRMT10
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids382 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.
Catalytic activity
- L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H+ + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 142 | |||||
Sequence: E | ||||||
Active site | 151 | |||||
Sequence: E |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | protein-arginine omega-N asymmetric methyltransferase activity | |
Biological Process | methylation |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein arginine N-methyltransferase PRMT10
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionA2Y953
Proteomes
Genome annotation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000294009 | 1-382 | Protein arginine N-methyltransferase PRMT10 | |||
Sequence: MASLPNGAASASAASSAAGGGPAVVDKEVDFANYFCTYSYLYHQKEMLCDRVRMDAYHSAVFRNAHHFRGKVVLDVGTGSGILAIWSAQAGARKVYAVEATNMAEHARELARANDVADIVEVIQGSMEDVVLPEKVDVIISEWMGYFLLRESMFDSVICARDRWLKPDGVMYPSHARMWLAPIRSDLAENKMEDLEIAMHDWNLFVEDTESYYGVNMNVLTKAYRAEHEKYYLKSAIWNNLHPNQVIGQAAVIKEIDCLTATVDEIREVRAQVTMPIKLDMTRLAALAGWFDVHFRGSKQNPATQEVELSTAPDVNGGTHWGQQVFLLTPPLKVNEGDNVKVSFTMVRSKENHRLMDMEFTYELHESSGKQLPAITTKIYLE |
Interaction
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-21 | Disordered | ||||
Sequence: MASLPNGAASASAASSAAGGG | ||||||
Domain | 28-359 | SAM-dependent MTase PRMT-type | ||||
Sequence: EVDFANYFCTYSYLYHQKEMLCDRVRMDAYHSAVFRNAHHFRGKVVLDVGTGSGILAIWSAQAGARKVYAVEATNMAEHARELARANDVADIVEVIQGSMEDVVLPEKVDVIISEWMGYFLLRESMFDSVICARDRWLKPDGVMYPSHARMWLAPIRSDLAENKMEDLEIAMHDWNLFVEDTESYYGVNMNVLTKAYRAEHEKYYLKSAIWNNLHPNQVIGQAAVIKEIDCLTATVDEIREVRAQVTMPIKLDMTRLAALAGWFDVHFRGSKQNPATQEVELSTAPDVNGGTHWGQQVFLLTPPLKVNEGDNVKVSFTMVRSKENHRLMDME | ||||||
Region | 189-229 | Dimerization arm | ||||
Sequence: ENKMEDLEIAMHDWNLFVEDTESYYGVNMNVLTKAYRAEHE |
Sequence similarities
Belongs to the class I-like SAM-binding methyltransferase superfamily. Protein arginine N-methyltransferase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length382
- Mass (Da)42,876
- Last updated2007-03-20 v1
- Checksum702A77F97C67AD15
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CM000131 EMBL· GenBank· DDBJ | EAY99613.1 EMBL· GenBank· DDBJ | Genomic DNA |