A2ANU3 · SYNG1_MOUSE
- ProteinSynapse differentiation-inducing gene protein 1
- GeneSyndig1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids258 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May regulate AMPA receptor content at nascent synapses, and have a role in postsynaptic development and maturation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell body | |
Cellular Component | dendritic shaft | |
Cellular Component | dendritic spine | |
Cellular Component | early endosome membrane | |
Cellular Component | excitatory synapse | |
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | plasma membrane | |
Cellular Component | postsynaptic density | |
Cellular Component | postsynaptic density membrane | |
Cellular Component | synaptic vesicle membrane | |
Molecular Function | glutamate receptor binding | |
Molecular Function | protein homodimerization activity | |
Biological Process | intracellular protein transport | |
Biological Process | positive regulation of synapse assembly | |
Biological Process | synaptic vesicle clustering |
Names & Taxonomy
Protein names
- Recommended nameSynapse differentiation-inducing gene protein 1
- Short namesSynDIG1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionA2ANU3
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type II membrane protein
Early endosome membrane ; Single-pass type II membrane protein
Note: Shuttles between the cell surface and early endosome membrane.
Features
Showing features for topological domain, transmembrane, intramembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-181 | Cytoplasmic | ||||
Sequence: MDGIIEQKSVLVHSKISDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPGSLEGGRSEPVQQLLDPNTLQQSVESHYRPNIILYSDGVLRSWGDGVATDCCETTFIEDRSPTKDSLEYPDGKFIDLSGDDIKIHTLSYDVEEEEELQELESDYSSDTESEDNFLMMPPRDH | ||||||
Transmembrane | 182-202 | Helical | ||||
Sequence: LGLSVFSMLCCFWPLGIAAFY | ||||||
Topological domain | 203-228 | Extracellular | ||||
Sequence: LSHETNKAVAKGDFHQASTSSRRALF | ||||||
Intramembrane | 229-249 | Helical | ||||
Sequence: LAVLSITIGTGIYVGVAVALI | ||||||
Topological domain | 250-258 | Extracellular | ||||
Sequence: AYLSKNNHL |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000394033 | 1-258 | Synapse differentiation-inducing gene protein 1 | |||
Sequence: MDGIIEQKSVLVHSKISDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPGSLEGGRSEPVQQLLDPNTLQQSVESHYRPNIILYSDGVLRSWGDGVATDCCETTFIEDRSPTKDSLEYPDGKFIDLSGDDIKIHTLSYDVEEEEELQELESDYSSDTESEDNFLMMPPRDHLGLSVFSMLCCFWPLGIAAFYLSHETNKAVAKGDFHQASTSSRRALFLAVLSITIGTGIYVGVAVALIAYLSKNNHL | ||||||
Modified residue | 137 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Brain-specific. Expressed in Purkinje neurons in cerebellum. Also detected in the hippocampus. Found at excitatory synapses and postsynaptic cells.
Developmental stage
Expressed during synaptogenesis. Found at the cell surface of excitatory synapses.
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length258
- Mass (Da)28,456
- Last updated2007-02-20 v1
- Checksum90580C01DD5C1267
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL831742 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL845436 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH466519 EMBL· GenBank· DDBJ | EDL28557.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC147352 EMBL· GenBank· DDBJ | AAI47353.1 EMBL· GenBank· DDBJ | mRNA | ||
BC147353 EMBL· GenBank· DDBJ | AAI47354.1 EMBL· GenBank· DDBJ | mRNA | ||
BC147660 EMBL· GenBank· DDBJ | AAI47661.1 EMBL· GenBank· DDBJ | mRNA | ||
BC147661 EMBL· GenBank· DDBJ | AAI47662.1 EMBL· GenBank· DDBJ | mRNA |