A2AKM8 · A2AKM8_MOUSE
- ProteinPaired box 5
- GenePax5
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids326 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Cellular Component | transcription regulator complex | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | tissue development |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionA2AKM8
Proteomes
Organism-specific databases
Subcellular Location
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 16-142 | Paired | ||||
Sequence: GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTK | ||||||
Compositional bias | 169-192 | Polar residues | ||||
Sequence: SVSTDSAGSSYSISGILGITSPSA | ||||||
Region | 169-218 | Disordered | ||||
Sequence: SVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRD | ||||||
Region | 268-289 | Disordered | ||||
Sequence: LQPEERPHRPQPPPMTVTDPQS | ||||||
Region | 301-326 | Disordered | ||||
Sequence: AGGSLPTPETDRGAQRLVSHPRPTLP |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length326
- Mass (Da)35,818
- Last updated2007-02-20 v1
- Checksum93738D7CB4CF54A7
Computationally mapped potential isoform sequences
There are 15 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q02650 | PAX5_MOUSE | Pax5 | 391 | ||
V9GXS5 | V9GXS5_MOUSE | Pax5 | 200 | ||
A2AKM5 | A2AKM5_MOUSE | Pax5 | 357 | ||
A2AKM6 | A2AKM6_MOUSE | Pax5 | 362 | ||
A2AKM7 | A2AKM7_MOUSE | Pax5 | 355 | ||
A0A0A6YVX2 | A0A0A6YVX2_MOUSE | Pax5 | 209 | ||
G3UYK4 | G3UYK4_MOUSE | Pax5 | 336 | ||
G3UZ71 | G3UZ71_MOUSE | Pax5 | 288 | ||
G3UZ86 | G3UZ86_MOUSE | Pax5 | 307 | ||
G3UXF6 | G3UXF6_MOUSE | Pax5 | 291 | ||
A0A087WST9 | A0A087WST9_MOUSE | Pax5 | 108 | ||
G3UY80 | G3UY80_MOUSE | Pax5 | 273 | ||
G3UX39 | G3UX39_MOUSE | Pax5 | 319 | ||
G3UW65 | G3UW65_MOUSE | Pax5 | 348 | ||
G3V008 | G3V008_MOUSE | Pax5 | 328 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 169-192 | Polar residues | ||||
Sequence: SVSTDSAGSSYSISGILGITSPSA |
Keywords
- Technical term