A1YL78 · ASIP_CALGE
- ProteinAgouti-signaling protein
- GeneASIP
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids132 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment) (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Molecular Function | melanocortin receptor binding | |
Molecular Function | neuropeptide hormone activity | |
Biological Process | hormone-mediated signaling pathway | |
Biological Process | melanin biosynthetic process | |
Biological Process | melanosome organization | |
Biological Process | positive regulation of melanin biosynthetic process |
Names & Taxonomy
Protein names
- Recommended nameAgouti-signaling protein
- Short namesASP
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Platyrrhini > Cebidae > Callitrichinae > Callithrix > Callithrix
Accessions
- Primary accessionA1YL78
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MDVTRLLLATLLVFLCFFAAYS | ||||||
Chain | PRO_0000285050 | 23-132 | Agouti-signaling protein | |||
Sequence: HLPPEEKLRDDRSLRSNSSVNLLDLPSVSIVALNKKSKKISRKEAEKKRSSKKEASKQKVARPRTPLSVPCVSTRGSCKPPAPACCHPCASCQCRFFRSACSCRVLNVNC | ||||||
Glycosylation | 39 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 93↔108 | |||||
Sequence: CVSTRGSCKPPAPACC | ||||||
Disulfide bond | 100↔114 | |||||
Sequence: CKPPAPACCHPCASC | ||||||
Disulfide bond | 107↔125 | |||||
Sequence: CCHPCASCQCRFFRSACSC | ||||||
Disulfide bond | 111↔132 | |||||
Sequence: CASCQCRFFRSACSCRVLNVNC | ||||||
Disulfide bond | 116↔123 | |||||
Sequence: CRFFRSAC |
Keywords
- PTM
PTM databases
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 61-93 | Disordered | ||||
Sequence: KISRKEAEKKRSSKKEASKQKVARPRTPLSVPC | ||||||
Domain | 93-132 | Agouti | ||||
Sequence: CVSTRGSCKPPAPACCHPCASCQCRFFRSACSCRVLNVNC |
Domain
The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length132
- Mass (Da)14,627
- Last updated2007-02-06 v1
- ChecksumD3DBC8964AABC220