A1YKT1 · TCP18_ARATH
- ProteinTranscription factor TCP18
- GeneTCP18
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids433 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription factor that prevents axillary bud outgrowth and delays early axillary bud development. Indirectly required for the auxin-induced control of apical dominance.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | transcription cis-regulatory region binding | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | regulation of secondary shoot formation | |
Biological Process | secondary shoot formation |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTranscription factor TCP18
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionA1YKT1
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000330792 | 1-433 | Transcription factor TCP18 | |||
Sequence: MNNNIFSTTTTINDDYMLFPYNDHYSSQPLLPFSPSSSINDILIHSTSNTSNNHLDHHHQFQQPSPFSHFEFAPDCALLTSFHPENNGHDDNQTIPNDNHHPSLHFPLNNTIVEQPTEPSETINLIEDSQRISTSQDPKMKKAKKPSRTDRHSKIKTAKGTRDRRMRLSLDVAKELFGLQDMLGFDKASKTVEWLLTQAKPEIIKIATTLSHHGCFSSGDESHIRPVLGSMDTSSDLCELASMWTVDDRGSNTNTTETRGNKVDGRSMRGKRKRPEPRTPILKKLSKEERAKARERAKGRTMEKMMMKMKGRSQLVKVVEEDAHDHGEIIKNNNRSQVNRSSFEMTHCEDKIEELCKNDRFAVCNEFIMNKKDHISNESYDLVNYKPNSSFPVINHHRSQGAANSIEQHQFTDLHYSFGAKPRDLMHNYQNMY |
Proteomic databases
Expression
Tissue specificity
Expressed in unelongated axillary buds, and, to a lower extent, in axillary structures such as flowers and siliques.
Induction
Induced during environmentally induced bud dormancy (planting density). Repressed transiently after shoot apical meristem (SAM) decapitation (release from apical dominance).
Developmental stage
Detected in axillary mersitems which appears in the axils of leaves after flowering. During bud vegetative development, down-regulated in the outer layers of the meristem, but accumulates transiently in young leaf primordia. In buds bearing flowers, restricted to the provascular tissue underlying the bud. Accumulates in axillary buds, but disappears at the time of bud outgrowth.
Gene expression databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | A1YKT1 | At4g03250 F4JI72 | 4 | EBI-15192731, EBI-15192535 | |
BINARY | A1YKT1 | At5g26749 F4K1A8 | 3 | EBI-15192731, EBI-15191587 | |
BINARY | A1YKT1 | BZIP43 Q9FMC2 | 3 | EBI-15192731, EBI-1237855 | |
BINARY | A1YKT1 | PYL9 Q84MC7 | 3 | EBI-15192731, EBI-2349513 | |
BINARY | A1YKT1 | RVE2 F4K5X6 | 3 | EBI-15192731, EBI-15194007 | |
BINARY | A1YKT1 | WOX4 Q6X7J9 | 3 | EBI-15192731, EBI-4459694 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 130-163 | Disordered | ||||
Sequence: QRISTSQDPKMKKAKKPSRTDRHSKIKTAKGTRD | ||||||
Domain | 148-206 | TCP | ||||
Sequence: RTDRHSKIKTAKGTRDRRMRLSLDVAKELFGLQDMLGFDKASKTVEWLLTQAKPEIIKI | ||||||
Compositional bias | 247-261 | Polar residues | ||||
Sequence: DDRGSNTNTTETRGN | ||||||
Region | 247-281 | Disordered | ||||
Sequence: DDRGSNTNTTETRGNKVDGRSMRGKRKRPEPRTPI | ||||||
Compositional bias | 262-281 | Basic and acidic residues | ||||
Sequence: KVDGRSMRGKRKRPEPRTPI | ||||||
Domain | 287-304 | R | ||||
Sequence: KEERAKARERAKGRTMEK |
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
A1YKT1-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length433
- Mass (Da)49,676
- Last updated2007-02-06 v1
- ChecksumE472DD229CAFBC1B
A1YKT1-2
- Name2
- Differences from canonical
- 226-229: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1I9LSP1 | A0A1I9LSP1_ARATH | BRC1 | 434 |
Sequence caution
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_033117 | 226-229 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 247-261 | Polar residues | ||||
Sequence: DDRGSNTNTTETRGN | ||||||
Compositional bias | 262-281 | Basic and acidic residues | ||||
Sequence: KVDGRSMRGKRKRPEPRTPI |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AM408560 EMBL· GenBank· DDBJ | CAL64010.1 EMBL· GenBank· DDBJ | mRNA | ||
EF062581 EMBL· GenBank· DDBJ | ABM05498.1 EMBL· GenBank· DDBJ | mRNA | ||
AP001303 EMBL· GenBank· DDBJ | BAB02213.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002686 EMBL· GenBank· DDBJ | AEE76115.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE76116.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | ANM65598.1 EMBL· GenBank· DDBJ | Genomic DNA |