A1XQU1 · PSB7_PIG
- ProteinProteasome subunit beta type-7
- GenePSMB7
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids277 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Within the 20S core complex, PSMB7 displays a trypsin-like activity.
Catalytic activity
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 44 | Nucleophile | ||||
Sequence: T |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nuclear body | |
Cellular Component | nucleus | |
Cellular Component | proteasome core complex | |
Cellular Component | proteasome core complex, beta-subunit complex | |
Molecular Function | endopeptidase activity | |
Molecular Function | threonine-type endopeptidase activity | |
Biological Process | proteasome-mediated ubiquitin-dependent protein catabolic process |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameProteasome subunit beta type-7
- EC number
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Suina > Suidae > Sus
Accessions
- Primary accessionA1XQU1
- Secondary accessions
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for propeptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Propeptide | PRO_0000311176 | 1-43 | Removed in mature form | |||
Sequence: MAAVSVYERPVGGFSFDNCRRNAILEADFAKKGYKLPTARKTG | ||||||
Chain | PRO_0000311177 | 44-277 | Proteasome subunit beta type-7 | |||
Sequence: TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPEMEEEEAKQLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPYSVPNKKGTRFGRYRCEKGTTAVLTEKVTALDIEVLEETVQTMDTS |
Keywords
- PTM
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
The 26S proteasome consists of a 20S proteasome core and two 19S regulatory subunits. The 20S proteasome core is a barrel-shaped complex made of 28 subunits that are arranged in four stacked rings. The two outer rings are each formed by seven alpha subunits, and the two inner rings are formed by seven beta subunits. The proteolytic activity is exerted by three beta-subunits PSMB5, PSMB6 and PSMB7.
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length277
- Mass (Da)29,980
- Last updated2007-11-13 v2
- ChecksumD8DFC5B018F6F287
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A5G2QPJ2 | A0A5G2QPJ2_PIG | PSMB7 | 275 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 229 | in Ref. 2; ABK55647 | ||||
Sequence: L → F |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP009124 EMBL· GenBank· DDBJ | BAF45330.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ629163 EMBL· GenBank· DDBJ | ABK55647.1 EMBL· GenBank· DDBJ | mRNA |