A1L3X4 · MT1DP_HUMAN
- ProteinPutative metallothionein MT1DP
- GeneMT1DP
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids
- Protein existenceUncertain
- Annotation score3/5
Function
function
Metallothioneins have a high content of cysteine residues that bind various heavy metals.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 5 | a divalent metal cation 1 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 7 | a divalent metal cation 1 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 7 | a divalent metal cation 2 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 13 | a divalent metal cation 2 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 15 | a divalent metal cation 2 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 15 | a divalent metal cation 3 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 19 | a divalent metal cation 3 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 21 | a divalent metal cation 1 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 26 | a divalent metal cation 2 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 29 | a divalent metal cation 3 (UniProtKB | ChEBI); in cluster B | ||||
Sequence: C | ||||||
Binding site | 33 | a divalent metal cation 4 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 34 | a divalent metal cation 4 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 34 | a divalent metal cation 5 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 36 | a divalent metal cation 5 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 37 | a divalent metal cation 5 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 37 | a divalent metal cation 6 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 41 | a divalent metal cation 6 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 44 | a divalent metal cation 4 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 44 | a divalent metal cation 6 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C | ||||||
Binding site | 48 | a divalent metal cation 4 (UniProtKB | ChEBI); in cluster A | ||||
Sequence: C |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | metal ion binding | |
Biological Process | cellular response to cadmium ion | |
Biological Process | cellular response to copper ion | |
Biological Process | cellular response to zinc ion | |
Biological Process | detoxification of copper ion | |
Biological Process | intracellular zinc ion homeostasis |
Keywords
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePutative metallothionein MT1DP
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA1L3X4
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000343426 | 1-49 | Putative metallothionein MT1DP | |||
Sequence: MDLSCSCATGGSCTCASSCKCKEYKCTSCKKNCCSCCPMGCAKCAQGCT |
Proteomic databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | A1L3X4 | KRTAP10-5 P60370 | 3 | EBI-10172129, EBI-10172150 | |
BINARY | A1L3X4 | KRTAP10-9 P60411 | 3 | EBI-10172129, EBI-10172052 | |
BINARY | A1L3X4 | MEOX2 P50222 | 3 | EBI-10172129, EBI-748397 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-29 | Beta | ||||
Sequence: MDLSCSCATGGSCTCASSCKCKEYKCTSC | ||||||
Region | 30-49 | Alpha | ||||
Sequence: KKNCCSCCPMGCAKCAQGCT |
Sequence similarities
Belongs to the metallothionein superfamily. Type 1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length49
- Mass (Da)4,983
- Last updated2007-02-06 v1
- ChecksumD3FCBF95F9FBEFA1
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 45 | in Ref. 1; AAO32959 | ||||
Sequence: A → S |
Keywords
- Technical term