A1L2G3 · BAP1_DANRE
- ProteinUbiquitin carboxyl-terminal hydrolase BAP1
- Genebap1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids755 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Deubiquitinating enzyme that plays a key role in chromatin by mediating deubiquitination of histone H2A. Catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1) (By similarity).
Catalytic activity
Features
Showing features for active site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 91 | Nucleophile | ||||
Sequence: C | ||||||
Active site | 169 | Proton donor | ||||
Sequence: H | ||||||
Site | 184 | Important for enzyme activity | ||||
Sequence: D |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Cellular Component | PR-DUB complex | |
Molecular Function | chromatin binding | |
Molecular Function | cysteine-type deubiquitinase activity | |
Biological Process | chromatin organization | |
Biological Process | cranial skeletal system development | |
Biological Process | negative regulation of DNA-templated transcription | |
Biological Process | Notch signaling pathway | |
Biological Process | protein deubiquitination | |
Biological Process | protein K48-linked deubiquitination | |
Biological Process | regulation of cell cycle | |
Biological Process | regulation of cell growth | |
Biological Process | ubiquitin-dependent protein catabolic process |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameUbiquitin carboxyl-terminal hydrolase BAP1
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionA1L2G3
- Secondary accessions
Proteomes
Organism-specific databases
Phenotypes & Variants
Disruption phenotype
Neuronal hyperplasia, suggesting a role in Notch signaling pathway.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000395819 | 1-755 | Ubiquitin carboxyl-terminal hydrolase BAP1 | |||
Sequence: MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQSPVYGFIFLFKWIEERRSRRKVSTLVDETSVIDDDIVNDMFFAHQLIPNSCATHALLSVLLNCSGVELGMTLSRMKAFTKGFNPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKDRLFELDGLKAYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKYESKLDILKRNRQIILEGLQQIREKKVIRMTQQESGQDRKQQDSSSSEDTPPVVKKEEVQETPIPSGAEQATPTEAQEGAASLPSPAGKVRSMAKPALPAGGAPPPAPLPAPSTNTIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRPPQPPYSDDEDDYDDEEEECSTAGVTNSRVRRKLGLRTRTMSRTAVGGVAAMEGQLALSVLAEKLKKEVQRKDALATTGSTPLNVRTEGRTGGISITSACQPSPTPSNESTDTASEIGSAFNSPLRSPARSQATTRPSSPVASHVGRVLFGEEEGLPRLDARHNRAVRDLGVLVSSTQLQLQEDGVIFALPPTEALEGLKKVGGVDKKKKEEASGPGGEEEVKEGPSVEMKAEDVKESVDVKPEKENLPTTDVENSTKPPGEKYTPKELLALLKYVEADIANYEVYLKEEVEKRKKYKIDDQRRTHNYDEFICTFISMLAQEGMLASLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ |
Proteomic databases
Interaction
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 5-214 | UCH | ||||
Sequence: WLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQSPVYGFIFLFKWIEERRSRRKVSTLVDETSVIDDDIVNDMFFAHQLIPNSCATHALLSVLLNCSGVELGMTLSRMKAFTKGFNPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKDRLFELDGLKAYPIDHGPWGEDEEWTDKARRVIMERI | ||||||
Region | 270-354 | Disordered | ||||
Sequence: MTQQESGQDRKQQDSSSSEDTPPVVKKEEVQETPIPSGAEQATPTEAQEGAASLPSPAGKVRSMAKPALPAGGAPPPAPLPAPST | ||||||
Compositional bias | 281-296 | Basic and acidic residues | ||||
Sequence: QQDSSSSEDTPPVVKK | ||||||
Compositional bias | 305-319 | Polar residues | ||||
Sequence: PSGAEQATPTEAQEG | ||||||
Region | 368-415 | Disordered | ||||
Sequence: HNYAKSPMQEEEDLAAGVGRSRPPQPPYSDDEDDYDDEEEECSTAGVT | ||||||
Compositional bias | 469-530 | Polar residues | ||||
Sequence: STPLNVRTEGRTGGISITSACQPSPTPSNESTDTASEIGSAFNSPLRSPARSQATTRPSSPV | ||||||
Region | 469-535 | Disordered | ||||
Sequence: STPLNVRTEGRTGGISITSACQPSPTPSNESTDTASEIGSAFNSPLRSPARSQATTRPSSPVASHVG | ||||||
Compositional bias | 593-640 | Basic and acidic residues | ||||
Sequence: GVDKKKKEEASGPGGEEEVKEGPSVEMKAEDVKESVDVKPEKENLPTT | ||||||
Region | 593-652 | Disordered | ||||
Sequence: GVDKKKKEEASGPGGEEEVKEGPSVEMKAEDVKESVDVKPEKENLPTTDVENSTKPPGEK | ||||||
Domain | 669-714 | UCH37-like C-terminal | ||||
Sequence: IANYEVYLKEEVEKRKKYKIDDQRRTHNYDEFICTFISMLAQEGML | ||||||
Region | 729-755 | Disordered | ||||
Sequence: GVSIGRLHKQRKPDRRKRSRPYKAKRQ | ||||||
Compositional bias | 730-755 | Basic residues | ||||
Sequence: VSIGRLHKQRKPDRRKRSRPYKAKRQ | ||||||
Motif | 743-748 | Nuclear localization signal | ||||
Sequence: RRKRSR |
Sequence similarities
Belongs to the peptidase C12 family. BAP1 subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length755
- Mass (Da)83,777
- Last updated2010-07-13 v2
- Checksum6DE37B40D438B535
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M2BLM6 | A0A8M2BLM6_DANRE | bap1 | 754 | ||
A0A8M2BL95 | A0A8M2BL95_DANRE | bap1 | 754 | ||
F1QJ12 | F1QJ12_DANRE | bap1 | 755 |
Sequence caution
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 54 | in Ref. 2; AAI29507 | ||||
Sequence: E → G | ||||||
Sequence conflict | 111 | in Ref. 2; AAI29507 | ||||
Sequence: T → A | ||||||
Compositional bias | 281-296 | Basic and acidic residues | ||||
Sequence: QQDSSSSEDTPPVVKK | ||||||
Compositional bias | 305-319 | Polar residues | ||||
Sequence: PSGAEQATPTEAQEG | ||||||
Sequence conflict | 443 | in Ref. 2; AAI29507 | ||||
Sequence: G → D | ||||||
Compositional bias | 469-530 | Polar residues | ||||
Sequence: STPLNVRTEGRTGGISITSACQPSPTPSNESTDTASEIGSAFNSPLRSPARSQATTRPSSPV | ||||||
Sequence conflict | 504 | in Ref. 2; AAI29507 | ||||
Sequence: S → P | ||||||
Compositional bias | 593-640 | Basic and acidic residues | ||||
Sequence: GVDKKKKEEASGPGGEEEVKEGPSVEMKAEDVKESVDVKPEKENLPTT | ||||||
Sequence conflict | 617-619 | in Ref. 2; AAI29507 | ||||
Sequence: VEM → AEI | ||||||
Sequence conflict | 627 | in Ref. 2; AAI29507 | ||||
Sequence: S → L | ||||||
Compositional bias | 730-755 | Basic residues | ||||
Sequence: VSIGRLHKQRKPDRRKRSRPYKAKRQ |
Keywords
- Technical term