A1KXI1 · BLOT3_BLOTA
- ProteinTrypsin Blo t 3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids266 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
Catalytic activity
Features
Showing features for active site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 75 | Charge relay system | ||||
Sequence: H | ||||||
Active site | 120 | Charge relay system | ||||
Sequence: D | ||||||
Site | 214 | Required for specificity | ||||
Sequence: D | ||||||
Active site | 220 | Charge relay system | ||||
Sequence: S |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | serine-type endopeptidase activity | |
Biological Process | proteolysis |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameTrypsin Blo t 3
- EC number
- Alternative names
- Allergen nameBlo t 3
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Chelicerata > Arachnida > Acari > Acariformes > Sarcoptiformes > Astigmata > Glycyphagoidea > Echimyopodidae > Blomia
Accessions
- Primary accessionA1KXI1
Subcellular Location
Phenotypes & Variants
Allergenic properties
Causes an allergic reaction in human (PubMed:12708986, PubMed:12752596).
Recombinant protein binds to IgE in 51% of the 45 patients tested allergic to B.tropicalis mites (PubMed:12708986).
Native protein binds to IgE in 57% of the 44 patients tested allergic to B.tropicalis mites (PubMed:12752596).
Recombinant protein binds to IgE in 51% of the 45 patients tested allergic to B.tropicalis mites (PubMed:12708986).
Native protein binds to IgE in 57% of the 44 patients tested allergic to B.tropicalis mites (PubMed:12752596).
Keywords
- Disease
Protein family/group databases
PTM/Processing
Features
Showing features for signal, propeptide, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-15 | |||||
Sequence: MKVLVLFCLVSLAAA | ||||||
Propeptide | PRO_0000447699 | 16-35 | ||||
Sequence: GPLKDALNKAQVDAFYAEGY | ||||||
Chain | PRO_5012813329 | 36-266 | Trypsin Blo t 3 | |||
Sequence: IVDGSNAADGDAPYQVSLQRTSHFCGGSIIADNYILTAAHCIQGLSASSLTIRYNTLRHNSGGLTVKASRIIGHEKYDSNTIDNDIALIQTASKMSTGTTNAQAIKLPEQGSDPKASSEVLITGWGTLSSGASSLPTKLQKVTVPIVDRKTCNANYGAVGADITDNMFCAGILNVGGKDACQGDSGGPVAANGVLVGAVSWGYGCAQAKYPGVYTRVGNYISWIKGKGVPV | ||||||
Disulfide bond | 60↔76 | |||||
Sequence: CGGSIIADNYILTAAHC | ||||||
Disulfide bond | 187↔204 | |||||
Sequence: CNANYGAVGADITDNMFC | ||||||
Disulfide bond | 216↔240 | |||||
Sequence: CQGDSGGPVAANGVLVGAVSWGYGC |
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 36-260 | Peptidase S1 | ||||
Sequence: IVDGSNAADGDAPYQVSLQRTSHFCGGSIIADNYILTAAHCIQGLSASSLTIRYNTLRHNSGGLTVKASRIIGHEKYDSNTIDNDIALIQTASKMSTGTTNAQAIKLPEQGSDPKASSEVLITGWGTLSSGASSLPTKLQKVTVPIVDRKTCNANYGAVGADITDNMFCAGILNVGGKDACQGDSGGPVAANGVLVGAVSWGYGCAQAKYPGVYTRVGNYISWIK |
Sequence similarities
Belongs to the peptidase S1 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length266
- Mass (Da)27,555
- Last updated2007-02-06 v1
- Checksum149251A6FC8CE0DC
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 38 | in Ref. 1; no nucleotide entry | ||||
Sequence: D → G | ||||||
Sequence conflict | 82 | in Ref. 1; no nucleotide entry | ||||
Sequence: A → T | ||||||
Sequence conflict | 96 | in Ref. 1; no nucleotide entry | ||||
Sequence: S → P | ||||||
Sequence conflict | 154 | in Ref. 1; no nucleotide entry | ||||
Sequence: E → K |