A0SIX6 · SNPF_AEDAE
- ProteinShort neuropeptide F
- GenesNPF
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids215 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Plays a role in controlling food intake and regulating body size.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | neuropeptide hormone activity | |
Biological Process | neuropeptide signaling pathway | |
Biological Process | regulation of multicellular organism growth | |
Biological Process | regulation of response to food |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameShort neuropeptide F
- Cleaved into 7 chains
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Nematocera > Culicoidea > Culicidae > Culicinae > Aedini > Aedes > Stegomyia
Accessions
- Primary accessionA0SIX6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, propeptide, peptide, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MCRINFTTLSLILVLWSGSLMS | ||||||
Propeptide | PRO_0000284734 | 23-56 | ||||
Sequence: EPSQNADGSIKGLYEYLLQREYAAPVSYADHQIK | ||||||
Peptide | PRO_0000284735 | 59-69 | RLRF peptide 1 | |||
Sequence: AVRSPSLRLRF | ||||||
Modified residue | 69 | Phenylalanine amide | ||||
Sequence: F | ||||||
Peptide | PRO_0000284736 | 73-89 | sNPF-associated peptide | |||
Sequence: SDPSVPVEPEDDDMVDQ | ||||||
Peptide | PRO_0000284737 | 91-101 | RLRF peptide 2 | |||
Sequence: SIRAPQLRLRF | ||||||
Modified residue | 101 | Phenylalanine amide | ||||
Sequence: F | ||||||
Peptide | PRO_0000284738 | 104-119 | sNPF peptide 2 | |||
Sequence: TDPLWSSFNENALLEE | ||||||
Peptide | PRO_0000284739 | 122-129 | RLRW peptide | |||
Sequence: APSQRLRW | ||||||
Modified residue | 129 | Tryptophan amide | ||||
Sequence: W | ||||||
Peptide | PRO_0000284740 | 132-145 | sNPF peptide 3 | |||
Sequence: SGGGMFSTNDVMQQ | ||||||
Peptide | PRO_0000284741 | 147-157 | RLRF peptide 3 | |||
Sequence: AIRAPQLRLRF | ||||||
Modified residue | 157 | Phenylalanine amide | ||||
Sequence: F | ||||||
Propeptide | PRO_0000284742 | 160-215 | ||||
Sequence: SDPSWAMFNEHQLDEQQFADATRQPSKTLRGDEPTSIESTEQVESEENSPSNMDEK |
Keywords
- PTM
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 173-215 | Disordered | ||||
Sequence: DEQQFADATRQPSKTLRGDEPTSIESTEQVESEENSPSNMDEK | ||||||
Compositional bias | 177-206 | Polar residues | ||||
Sequence: FADATRQPSKTLRGDEPTSIESTEQVESEE |
Sequence similarities
Belongs to the NPY family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
A0SIX6-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameA
- Length215
- Mass (Da)24,637
- Last updated2007-04-17 v2
- Checksum1A0236899C40B0A8
A0SIX6-2
- NameB
- Differences from canonical
- 201-215: QVESEENSPSNMDEK → SAQCVSSSEAQR
Features
Showing features for sequence conflict, compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 14 | in Ref. 1; ABE72968 | ||||
Sequence: V → A | ||||||
Sequence conflict | 77 | in Ref. 1; ABE72968 | ||||
Sequence: V → M | ||||||
Sequence conflict | 162 | in Ref. 1; ABE72968 | ||||
Sequence: P → T | ||||||
Compositional bias | 177-206 | Polar residues | ||||
Sequence: FADATRQPSKTLRGDEPTSIESTEQVESEE | ||||||
Alternative sequence | VSP_052376 | 201-215 | in isoform B | |||
Sequence: QVESEENSPSNMDEK → SAQCVSSSEAQR |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DQ459411 EMBL· GenBank· DDBJ | ABE72968.1 EMBL· GenBank· DDBJ | mRNA | ||
CH477894 EMBL· GenBank· DDBJ | EAT35275.1 EMBL· GenBank· DDBJ | Genomic DNA |