A0MZ67 · SHOT1_RAT
- ProteinShootin-1
- GeneShtn1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids633 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in the generation of internal asymmetric signals required for neuronal polarization and neurite outgrowth (PubMed:17030985, PubMed:17439943, PubMed:18519736, PubMed:20664640).
Mediates netrin-1-induced F-actin-substrate coupling or 'clutch engagement' within the axon growth cone through activation of CDC42, RAC1 and PAK1-dependent signaling pathway, thereby converting the F-actin retrograde flow into traction forces, concomitantly with filopodium extension and axon outgrowth (PubMed:18519736, PubMed:23453953).
Plays a role in cytoskeletal organization by regulating the subcellular localization of phosphoinositide 3-kinase (PI3K) activity at the axonal growth cone (PubMed:17030985).
Also plays a role in regenerative neurite outgrowth (PubMed:20664640).
In the developing cortex, cooperates with KIF20B to promote both the transition from the multipolar to the bipolar stage and the radial migration of cortical neurons from the ventricular zone toward the superficial layer of the neocortex. Involved in the accumulation of phosphatidylinositol 3,4,5-trisphosphate (PIP3) in the growth cone of primary hippocampal neurons (By similarity).
Mediates netrin-1-induced F-actin-substrate coupling or 'clutch engagement' within the axon growth cone through activation of CDC42, RAC1 and PAK1-dependent signaling pathway, thereby converting the F-actin retrograde flow into traction forces, concomitantly with filopodium extension and axon outgrowth (PubMed:18519736, PubMed:23453953).
Plays a role in cytoskeletal organization by regulating the subcellular localization of phosphoinositide 3-kinase (PI3K) activity at the axonal growth cone (PubMed:17030985).
Also plays a role in regenerative neurite outgrowth (PubMed:20664640).
In the developing cortex, cooperates with KIF20B to promote both the transition from the multipolar to the bipolar stage and the radial migration of cortical neurons from the ventricular zone toward the superficial layer of the neocortex. Involved in the accumulation of phosphatidylinositol 3,4,5-trisphosphate (PIP3) in the growth cone of primary hippocampal neurons (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameShootin-1
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionA0MZ67
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes in multiple growth cones at neurite tips before the neuronal symmetry-breaking step (PubMed:23453953).
Accumulates in growth cones of a single nascent axon in a neurite length-dependent manner during the neuronal symmetry-breaking step; when absent from the nascent axon's siblings, probably due to competitive transport, prevents the formation of surplus axons (PubMed:17030985, PubMed:23453953).
Transported anterogradely from the soma to the axon growth cone in an actin and myosin-dependent manner and passively diffuses back to the cell bodies (PubMed:23453953).
Colocalized with L1CAM in close apposition with actin filaments in filopodia and lamellipodia of axonal growth cones in hippocampal neurons (PubMed:18519736).
Exhibits retrograde movements in filopodia and lamellopodia of axonal growth cones (PubMed:18519736).
Colocalized with KIF20B along microtubules to the tip of the growing cone in primary hippocampal neurons. Recruited to the growth cone of developing axon in a KIF20B- and microtubule-dependent manner (By similarity).
Accumulates in growth cones of a single nascent axon in a neurite length-dependent manner during the neuronal symmetry-breaking step; when absent from the nascent axon's siblings, probably due to competitive transport, prevents the formation of surplus axons (PubMed:17030985, PubMed:23453953).
Transported anterogradely from the soma to the axon growth cone in an actin and myosin-dependent manner and passively diffuses back to the cell bodies (PubMed:23453953).
Colocalized with L1CAM in close apposition with actin filaments in filopodia and lamellipodia of axonal growth cones in hippocampal neurons (PubMed:18519736).
Exhibits retrograde movements in filopodia and lamellopodia of axonal growth cones (PubMed:18519736).
Colocalized with KIF20B along microtubules to the tip of the growing cone in primary hippocampal neurons. Recruited to the growth cone of developing axon in a KIF20B- and microtubule-dependent manner (By similarity).
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 101 | Inhibits F-actin retrograde flow at the peripheral region of growth cones; when associated with A-249. | ||||
Sequence: S → A | ||||||
Mutagenesis | 101 | Does not inhibit F-actin retrograde flow at the peripheral region of growth cones; when associated with D-249. | ||||
Sequence: S → D | ||||||
Mutagenesis | 249 | Inhibits F-actin retrograde flow at the peripheral region of growth cones; when associated with A-101. | ||||
Sequence: S → A | ||||||
Mutagenesis | 249 | Does not inhibit F-actin retrograde flow at the peripheral region of growth cones; when associated with D-101. | ||||
Sequence: S → D |
PTM/Processing
Features
Showing features for modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 1 | N-acetylmethionine | ||||
Sequence: M | ||||||
Chain | PRO_0000295743 | 1-633 | Shootin-1 | |||
Sequence: MNSSDEEKQLQLITSLKEQAIGEYEDLRAENQKTKETCDKIRQERDEAVKKLEEFQKISHMVIEEVNFMQNHLEIEKTCRESAEALATKLNKENKTLKRISMLYMAKLGPDVITEEINIDDDDPGTDTDAAAETCVSVQCQKQIKELRDQIVSVQEEKKVLAIELESLKSKLGEVMEEVNKVKQEKAVLNSEVLEQRKVLEKCNRVSVLAVEEYEELQVNLELEKDLRKKAESFAQEMFIEQNKLKRQSHLLLQSSLPDQQLLKALDENAKLIQQLEEERIQHQQKVKELEERLENEALHKEIHNLRQQLELLEDDKRELEQKYQSSEEKARNLKHSVDELQKRVNQSENSVPPPPPPPPPLPPPPPNPIRSLMSMIRKRSHPSGGSTKKEKATQPETAEEVTDLKRQAVEEMMDRIKKGVHLRPVNQTARPKAKPDSLKGSESAVDELKGILGTLNKSTSSRSLKSLGPENSETELERILRRRKLTAEADSSSPTGILATSESKSMPVLGSVSSVTKSALNKKTLEAEFNNPCPLTPEPGEGPRKLEGCTNSKVTFQPPSKGGYRRKCVGSENQSEPVVVLDPVSTHEPQTKDQAAEKDPTQCKEEERGETQPEFKEDSSGGKTGETDSSNC | ||||||
Modified residue | 3 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 4 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 101 | Phosphoserine; by PAK1 | ||||
Sequence: S | ||||||
Modified residue | 249 | Phosphoserine; by PAK1 | ||||
Sequence: S | ||||||
Modified residue | 375 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 473 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 487 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 494 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 496 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 506 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 515 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 537 | Phosphothreonine | ||||
Sequence: T |
Post-translational modification
Phosphorylated on Ser-101 and Ser-249 by PAK1 through a CDC42- and RAC1-dependent signaling pathway, which enhances its association with F-actin retrograde flow in filopodia and lamellipodia of axonal growth cones (PubMed:23453953).
Phosphorylation on Ser-101 and Ser-249 is increased by netrin-1 (PubMed:23453953).
Phosphorylation on Ser-101 and Ser-249 is increased by netrin-1 (PubMed:23453953).
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Brain-specific (at protein level) (PubMed:17030985).
Expressed in hippocampal neurons (PubMed:18519736).
Expressed in hippocampal neurons (PubMed:18519736).
Induction
Up-regulated by axonal regeneration (PubMed:20664640).
Developmental stage
Expressed in hippocampal neurons at 18 dpc (PubMed:23408951).
Expressed at high level both in hippocampal neurons and in brain, during the period of axon formation and elongation. Accumulates in axonal growth cones during the stage 2/3 transition. Accumulates asymmetrically in a single neurite before polarization, while it is depleted in its sibling neurites, through competitive transport to multiple neurites. Transported anterogradely to the growth cones and diffused back to the soma (at protein level) (PubMed:17030985).
Expressed at high level both in hippocampal neurons and in brain, during the period of axon formation and elongation. Accumulates in axonal growth cones during the stage 2/3 transition. Accumulates asymmetrically in a single neurite before polarization, while it is depleted in its sibling neurites, through competitive transport to multiple neurites. Transported anterogradely to the growth cones and diffused back to the soma (at protein level) (PubMed:17030985).
Interaction
Subunit
Interacts with PFN2. Interacts (via N-terminus) with KIF20B; this interaction is direct and promotes the association of SHTN1 to microtubules in primary neurons. Associates with microtubule (By similarity).
Interacts with L1CAM; this interaction occurs in axonal growth cones (PubMed:18519736).
Interacts with actin filament retrograde flow; this interaction is enhanced in a netrin-1- and PAK1-dependent manner and promotes F-actin-substrate coupling and concomitant formation of traction forces at axonal growth cones (PubMed:18519736, PubMed:23453953).
Interacts with RUFY3 (PubMed:17030985).
Interacts with L1CAM; this interaction occurs in axonal growth cones (PubMed:18519736).
Interacts with actin filament retrograde flow; this interaction is enhanced in a netrin-1- and PAK1-dependent manner and promotes F-actin-substrate coupling and concomitant formation of traction forces at axonal growth cones (PubMed:18519736, PubMed:23453953).
Interacts with RUFY3 (PubMed:17030985).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | A0MZ67 | Pik3r1 Q63787 | 2 | EBI-1392040, EBI-518443 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for coiled coil, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 7-353 | |||||
Sequence: EKQLQLITSLKEQAIGEYEDLRAENQKTKETCDKIRQERDEAVKKLEEFQKISHMVIEEVNFMQNHLEIEKTCRESAEALATKLNKENKTLKRISMLYMAKLGPDVITEEINIDDDDPGTDTDAAAETCVSVQCQKQIKELRDQIVSVQEEKKVLAIELESLKSKLGEVMEEVNKVKQEKAVLNSEVLEQRKVLEKCNRVSVLAVEEYEELQVNLELEKDLRKKAESFAQEMFIEQNKLKRQSHLLLQSSLPDQQLLKALDENAKLIQQLEEERIQHQQKVKELEERLENEALHKEIHNLRQQLELLEDDKRELEQKYQSSEEKARNLKHSVDELQKRVNQSENSVP | ||||||
Region | 343-508 | Disordered | ||||
Sequence: KRVNQSENSVPPPPPPPPPLPPPPPNPIRSLMSMIRKRSHPSGGSTKKEKATQPETAEEVTDLKRQAVEEMMDRIKKGVHLRPVNQTARPKAKPDSLKGSESAVDELKGILGTLNKSTSSRSLKSLGPENSETELERILRRRKLTAEADSSSPTGILATSESKSMP | ||||||
Compositional bias | 350-371 | Pro residues | ||||
Sequence: NSVPPPPPPPPPLPPPPPNPIR | ||||||
Compositional bias | 393-422 | Basic and acidic residues | ||||
Sequence: ATQPETAEEVTDLKRQAVEEMMDRIKKGVH | ||||||
Compositional bias | 454-471 | Polar residues | ||||
Sequence: GTLNKSTSSRSLKSLGPE | ||||||
Compositional bias | 472-489 | Basic and acidic residues | ||||
Sequence: NSETELERILRRRKLTAE | ||||||
Compositional bias | 490-508 | Polar residues | ||||
Sequence: ADSSSPTGILATSESKSMP | ||||||
Region | 525-633 | Disordered | ||||
Sequence: TLEAEFNNPCPLTPEPGEGPRKLEGCTNSKVTFQPPSKGGYRRKCVGSENQSEPVVVLDPVSTHEPQTKDQAAEKDPTQCKEEERGETQPEFKEDSSGGKTGETDSSNC | ||||||
Compositional bias | 592-624 | Basic and acidic residues | ||||
Sequence: TKDQAAEKDPTQCKEEERGETQPEFKEDSSGGK |
Domain
The N-terminus region is necessary for interaction with actin retrograde filament flow and accumulation in neuronal growth cones (PubMed:18519736).
Sequence similarities
Belongs to the shootin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
A0MZ67-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsShootin2
- Length633
- Mass (Da)71,446
- Last updated2006-12-12 v1
- Checksum7E982A943E7E98C5
A0MZ67-2
- Name2
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0G2K9C4 | A0A0G2K9C4_RAT | Shtn1 | 610 | ||
A0A8I6AFL7 | A0A8I6AFL7_RAT | Shtn1 | 634 | ||
D4A6P3 | D4A6P3_RAT | Shtn1 | 601 |
Features
Showing features for compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 350-371 | Pro residues | ||||
Sequence: NSVPPPPPPPPPLPPPPPNPIR | ||||||
Compositional bias | 393-422 | Basic and acidic residues | ||||
Sequence: ATQPETAEEVTDLKRQAVEEMMDRIKKGVH | ||||||
Alternative sequence | VSP_027056 | 454-456 | in isoform 2 | |||
Sequence: GTL → ASQ | ||||||
Compositional bias | 454-471 | Polar residues | ||||
Sequence: GTLNKSTSSRSLKSLGPE | ||||||
Alternative sequence | VSP_027057 | 457-633 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 472-489 | Basic and acidic residues | ||||
Sequence: NSETELERILRRRKLTAE | ||||||
Compositional bias | 490-508 | Polar residues | ||||
Sequence: ADSSSPTGILATSESKSMP | ||||||
Compositional bias | 592-624 | Basic and acidic residues | ||||
Sequence: TKDQAAEKDPTQCKEEERGETQPEFKEDSSGGK |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
EF055485 EMBL· GenBank· DDBJ | ABK56020.1 EMBL· GenBank· DDBJ | mRNA | ||
EF055488 EMBL· GenBank· DDBJ | ABK56023.1 EMBL· GenBank· DDBJ | mRNA |