A0M8Q6 · IGLC7_HUMAN
- ProteinImmunoglobulin lambda constant 7
- GeneIGLC7
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids106 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Constant region of immunoglobulin light chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:20176268, PubMed:22158414).
The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268).
The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268).
Miscellaneous
Displays the following serological isotype: Ke+, Oz- and two of the three characteristic amino acids of Mgc-isotype: Ala-6 and Ser-8 but instead of Thr-57 it displays Lys-57. Ke+ has Gly-46 and Oz- has Arg-83.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | extracellular space | |
Cellular Component | IgA immunoglobulin complex | |
Cellular Component | IgD immunoglobulin complex | |
Cellular Component | IgE immunoglobulin complex | |
Cellular Component | IgG immunoglobulin complex | |
Cellular Component | IgM immunoglobulin complex | |
Cellular Component | plasma membrane | |
Molecular Function | antigen binding | |
Biological Process | adaptive immune response | |
Biological Process | B cell receptor signaling pathway | |
Biological Process | immunoglobulin mediated immune response |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameImmunoglobulin lambda constant 7
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0M8Q6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_077896 | 34 | in IMGTALLELEIGLC7*01 | |||
Sequence: N → Y |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1 variant from UniProt as well as other sources including ClinVar and dbSNP.
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000393470 | 1-106 | Immunoglobulin lambda constant 7 | |||
Sequence: GQPKAAPSVTLFPPSSEELQANKATLVCLVSDFNPGAVTVAWKADGSPVKVGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCRVTHEGSTVEKTVAPAECS | ||||||
Disulfide bond | 28↔87 | |||||
Sequence: CLVSDFNPGAVTVAWKADGSPVKVGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSC | ||||||
Disulfide bond | 105 | Interchain (with heavy chain) | ||||
Sequence: C |
Keywords
- PTM
Proteomic databases
Interaction
Subunit
Immunoglobulins are composed of two identical heavy chains and two identical light chains; disulfide-linked.
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 7-101 | Ig-like | ||||
Sequence: PSVTLFPPSSEELQANKATLVCLVSDFNPGAVTVAWKADGSPVKVGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCRVTHEGSTVEKTVA |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length106
- Mass (Da)11,254
- Last updated2017-03-15 v3
- Checksum372937A232ABE662
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A5H1ZRQ7 | A0A5H1ZRQ7_HUMAN | IGLC7 | 106 |
Sequence caution
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: G |
Polymorphism
There are several alleles. The sequence shown is that of IMGT allele IGLC7*03.
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X51755 EMBL· GenBank· DDBJ | CAA36053.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
D87017 EMBL· GenBank· DDBJ | BAA20016.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
AC245028 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471095 EMBL· GenBank· DDBJ | EAW59556.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation |