A0JMU6 · A0JMU6_XENLA
- ProteinStim1 protein
- Genestim1.L
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids668 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Molecular Function | calcium channel regulator activity | |
Molecular Function | metal ion binding | |
Biological Process | calcium ion transport | |
Biological Process | regulation of transport |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Pipoidea > Pipidae > Xenopodinae > Xenopus > Xenopus
Accessions
- Primary accessionA0JMU6
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Single-pass type I membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 203-221 | Helical | ||||
Sequence: FMLVVSIVIGVGGCWFAYI |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MLWCRTLLWALCASFLQPSRP | ||||||
Chain | PRO_5033207185 | 22-668 | ||||
Sequence: ESPTESTEEDPMLSEFCRIDKLLCHSTDELLSFEAVMSIHKQMDDDANGSVDVEESDEFLREDLNYHDPTAKHSTFHGEDKLISVEDLWNSWKISEVYNWTVDEVAQWLITYVELPQYEETFRKLQLSGRDMPRLAIANATMTGTLLKMTDRSQRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSEDHMKKMMKDLEGLHRAEQSLHDLQERLQKAQEEHHTVEVEKVHLEKKLQNEISLAKQEAQRLRELREGTENELSRQKYAEQELEQVRMALKNAEKELESHSNWSAPDALQKWLQLTHEVEVQYYNIKKQNAEKQLMLAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVTAALRERLHRWQQIETLCGFQIVNNPGLHALMTALNIDPSLMGVSRPAPTHFIMSDDLDDLDEDIVSPITMQSPNLSLRQRHVDSQLALGPQRDLSRSDSESSIPYMIEQRVSGHSSKIPSSKALPRTLEEVPSGSQTPNGGNRHLELANVGAGHESVPESPQMSNKLSEKSPSLGEISTAGTIQSHSDSSRSHSPSSTEADTPSPGTESKHNNSKGTRIPQLAGKKAVAEDDSGSTGEDTDSVSGKKKLTLKIFKKPKK |
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, coiled coil, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 121-179 | SAM | ||||
Sequence: WTVDEVAQWLITYVELPQYEETFRKLQLSGRDMPRLAIANATMTGTLLKMTDRSQRQKL | ||||||
Coiled coil | 240-330 | |||||
Sequence: LHRAEQSLHDLQERLQKAQEEHHTVEVEKVHLEKKLQNEISLAKQEAQRLRELREGTENELSRQKYAEQELEQVRMALKNAEKELESHSNW | ||||||
Region | 518-668 | Disordered | ||||
Sequence: QRVSGHSSKIPSSKALPRTLEEVPSGSQTPNGGNRHLELANVGAGHESVPESPQMSNKLSEKSPSLGEISTAGTIQSHSDSSRSHSPSSTEADTPSPGTESKHNNSKGTRIPQLAGKKAVAEDDSGSTGEDTDSVSGKKKLTLKIFKKPKK | ||||||
Compositional bias | 567-628 | Polar residues | ||||
Sequence: PESPQMSNKLSEKSPSLGEISTAGTIQSHSDSSRSHSPSSTEADTPSPGTESKHNNSKGTRI |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length668
- Mass (Da)75,452
- Last updated2006-12-12 v1
- Checksum6D5202EB88C8AB51
Computationally mapped potential isoform sequences
There are 12 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8J1M6X5 | A0A8J1M6X5_XENLA | stim1.L | 776 | ||
A0A8J1M6Y0 | A0A8J1M6Y0_XENLA | stim1.L | 695 | ||
A0A8J1M6Y5 | A0A8J1M6Y5_XENLA | stim1.L | 575 | ||
A0A8J1M5Y1 | A0A8J1M5Y1_XENLA | stim1.L | 482 | ||
A0A8J1M5V7 | A0A8J1M5V7_XENLA | stim1.L | 686 | ||
A0A8J1M5V8 | A0A8J1M5V8_XENLA | stim1.L | 712 | ||
A0A8J1M5W2 | A0A8J1M5W2_XENLA | stim1.L | 669 | ||
A0A8J1M5W4 | A0A8J1M5W4_XENLA | stim1.L | 558 | ||
A0A8J1M5X1 | A0A8J1M5X1_XENLA | stim1.L | 713 | ||
A0A8J1M5X6 | A0A8J1M5X6_XENLA | stim1.L | 685 | ||
A0A8J1M7P9 | A0A8J1M7P9_XENLA | stim1.L | 696 | ||
A0A8J1M7Q4 | A0A8J1M7Q4_XENLA | stim1.L | 644 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 567-628 | Polar residues | ||||
Sequence: PESPQMSNKLSEKSPSLGEISTAGTIQSHSDSSRSHSPSSTEADTPSPGTESKHNNSKGTRI |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC126011 EMBL· GenBank· DDBJ | AAI26012.1 EMBL· GenBank· DDBJ | mRNA |