A0AAA9TE92 · A0AAA9TE92_BOVIN
- Protein[histone H3]-trimethyl-L-lysine(9) demethylase
- GeneKDM4C
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids997 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
Catalytic activity
- 2 2-oxoglutarate + N6,N6,N6-trimethyl-L-lysyl9-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N6-methyl-L-lysyl9-[histone H3] + 2 succinate
2 CHEBI:16810 + RHEA-COMP:15538 CHEBI:61961 Position: 9+ 2 CHEBI:15379 = 2 CHEBI:16526 + 2 CHEBI:16842 + RHEA-COMP:15542 CHEBI:61929 Position: 9+ 2 CHEBI:30031
Cofactor
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | dioxygenase activity | |
Molecular Function | histone H3K9 demethylase activity | |
Molecular Function | metal ion binding |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended name[histone H3]-trimethyl-L-lysine(9) demethylase
- EC number
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Ruminantia > Pecora > Bovidae > Bovinae > Bos
Accessions
- Primary accessionA0AAA9TE92
Proteomes
Organism-specific databases
Subcellular Location
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 16-58 | JmjN | ||||
Sequence: IMTFRPTMEEFREFNRYLAYMESKGAHRAGLAKVIPPKEWKPR | ||||||
Domain | 144-310 | JmjC | ||||
Sequence: DEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFLRHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWIDYGKVAKLCTC | ||||||
Region | 367-415 | Disordered | ||||
Sequence: RKASRSFQCTSSHSKRPKNEEDEKLSAIVGGAEGPAPDPDPGDLKDDGK | ||||||
Region | 487-597 | Disordered | ||||
Sequence: IFSGQVTSEESEPCKLPWPKSPESYSSVAESSSALTEEEESDVESRGNGLEPGEVPAVPSGQRNGFKVPSRTEGETKTAKSWRHPLSKPPARSPMTLVKQQATSDEDLPEV | ||||||
Domain | 749-862 | PHD-type | ||||
Sequence: TAECCLCNLRGGALKETKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQRLKLKCMFCRHRVKKVSGACIQCSYGRCPASFHVTCAHAAGVLMEPDDWPYVVNITCFRHK |
Sequence similarities
Belongs to the JHDM3 histone demethylase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length997
- Mass (Da)112,598
- Last updated2024-05-29 v1
- ChecksumA1AEA49F7A203D90
Computationally mapped potential isoform sequences
There are 8 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0AAA9SM03 | A0AAA9SM03_BOVIN | KDM4C | 1053 | ||
A0AAA9SM09 | A0AAA9SM09_BOVIN | KDM4C | 152 | ||
A0A3Q1MT70 | A0A3Q1MT70_BOVIN | KDM4C | 1019 | ||
A0A3Q1MQX9 | A0A3Q1MQX9_BOVIN | KDM4C | 953 | ||
F1MPE4 | F1MPE4_BOVIN | KDM4C | 951 | ||
A0A3Q1MHE4 | A0A3Q1MHE4_BOVIN | KDM4C | 188 | ||
A0A3Q1MFS1 | A0A3Q1MFS1_BOVIN | KDM4C | 988 | ||
A0AAA9S330 | A0AAA9S330_BOVIN | KDM4C | 810 |
Keywords
- Technical term