A0AA34QVT1 · A0AA34QVT1_HUMAN
- ProteinCalcium voltage-gated channel subunit alpha1 C
- GeneCACNA1C
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids255 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | monoatomic ion channel complex | |
Molecular Function | calcium channel activity |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0AA34QVT1
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 6-26 | Helical | ||||
Sequence: LFLIIFTVEAFLKVIAYGLLF | ||||||
Transmembrane | 38-56 | Helical | ||||
Sequence: LLDFIIVVVGLFSAILEQA | ||||||
Transmembrane | 109-131 | Helical | ||||
Sequence: LLHIALLVLFVIIIYAIIGLELF |
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 393 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 3-213 | Ion transport | ||||
Sequence: VEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWR | ||||||
Region | 220-255 | Disordered | ||||
Sequence: EGQGPGRFPEAAGEAAARRGSQRLPGLDHSGRRHRS |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusFragment
- Length255
- Mass (Da)28,097
- Last updated2024-01-24 v1
- Checksum17CCA485E063935D
Computationally mapped potential isoform sequences
There are 19 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q13936 | CAC1C_HUMAN | CACNA1C | 2221 | ||
A0A804HHT8 | A0A804HHT8_HUMAN | CACNA1C | 351 | ||
A0A804HI37 | A0A804HI37_HUMAN | CACNA1C | 2168 | ||
A0A804HIR0 | A0A804HIR0_HUMAN | CACNA1C | 2251 | ||
A0A804HIZ0 | A0A804HIZ0_HUMAN | CACNA1C | 2138 | ||
A0A804HIJ8 | A0A804HIJ8_HUMAN | CACNA1C | 2168 | ||
A0A5F9ZHD9 | A0A5F9ZHD9_HUMAN | CACNA1C | 125 | ||
A0A0A0MSA1 | A0A0A0MSA1_HUMAN | CACNA1C | 2173 | ||
A0A804HJR1 | A0A804HJR1_HUMAN | CACNA1C | 2168 | ||
A0A804HJB6 | A0A804HJB6_HUMAN | CACNA1C | 2168 | ||
A0A0A0MR67 | A0A0A0MR67_HUMAN | CACNA1C | 2173 | ||
A0A804HKE9 | A0A804HKE9_HUMAN | CACNA1C | 2152 | ||
A0A804HKC4 | A0A804HKC4_HUMAN | CACNA1C | 2193 | ||
E9PDI6 | E9PDI6_HUMAN | CACNA1C | 2198 | ||
F5GY28 | F5GY28_HUMAN | CACNA1C | 2209 | ||
A0A087WUX4 | A0A087WUX4_HUMAN | CACNA1C | 462 | ||
F5H522 | F5H522_HUMAN | CACNA1C | 2163 | ||
F5H638 | F5H638_HUMAN | CACNA1C | 371 | ||
Q5V9X8 | Q5V9X8_HUMAN | CACNA1C | 225 |
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: E |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC005293 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC005342 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC005344 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC005414 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC005866 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC006051 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF455573 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF455574 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |