A0A9P6R4K6 · A0A9P6R4K6_9FUNG
- ProteinATP-dependent DNA helicase II subunit 2
- GeneKU80
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids1494 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Single-stranded DNA-dependent ATP-dependent helicase. Involved in non-homologous end joining (NHEJ) DNA double strand break repair. DNA-binding is sequence-independent but has a high affinity to nicks in double-stranded DNA and to the ends of duplex DNA. Binds to naturally occurring chromosomal ends, and therefore provides chromosomal end protection. Required also for telomere recombination to repair telomeric ends in the absence of telomerase. KU70, of the KU70/KU80 heterodimer, binds to the stem loop of TLC1, the RNA component of telomerase. Involved in telomere maintenance. Interacts with telomeric repeats and subtelomeric sequences thereby controlling telomere length and protecting against subtelomeric rearrangement. Maintains telomeric chromatin, which is involved in silencing the expression of genes located at the telomere. Required for mating-type switching.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromosome, telomeric region | |
Cellular Component | Ku70:Ku80 complex | |
Molecular Function | ATP binding | |
Molecular Function | damaged DNA binding | |
Molecular Function | double-stranded DNA binding | |
Molecular Function | helicase activity | |
Molecular Function | hydrolase activity | |
Molecular Function | telomeric DNA binding | |
Biological Process | DNA recombination | |
Biological Process | double-strand break repair via nonhomologous end joining | |
Biological Process | telomere maintenance |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameATP-dependent DNA helicase II subunit 2
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Fungi > Fungi incertae sedis > Mucoromycota > Mortierellomycotina > Mortierellomycetes > Mortierellales > Mortierellaceae > Dissophora
Accessions
- Primary accessionA0A9P6R4K6
Proteomes
Subcellular Location
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 140-173 | Disordered | ||||
Sequence: SLMSRLEQMGSESKKRRLSVDMADVESDQGSTSF | ||||||
Compositional bias | 148-162 | Basic and acidic residues | ||||
Sequence: MGSESKKRRLSVDMA | ||||||
Domain | 246-278 | C2H2-type | ||||
Sequence: YMCEWENCVVKKKPFHKHHQVIRHMRTHTGEKP | ||||||
Domain | 279-308 | C2H2-type | ||||
Sequence: FICNVDGCGKKFARSDSLLEHSRKHIGTPV | ||||||
Region | 342-508 | Disordered | ||||
Sequence: QSSNFDSIARDSASGASRDGSRPDRMAPDQALSPKEGKQASSDQAPLEKRAQADGAESRPSAPGAGQALASAPGALPTSNTTAMSASSLSTQQWPERPPHPGQFAGRMGPSYGAVSKQNMSHHHRPSSDLTTLHRTRGHAHTGSLGFSKMDIHDPPRHRPYGHSHSR | ||||||
Compositional bias | 414-438 | Polar residues | ||||
Sequence: PGALPTSNTTAMSASSLSTQQWPER | ||||||
Compositional bias | 463-477 | Basic and acidic residues | ||||
Sequence: HHHRPSSDLTTLHRT | ||||||
Compositional bias | 492-508 | Basic and acidic residues | ||||
Sequence: DIHDPPRHRPYGHSHSR | ||||||
Region | 544-566 | Disordered | ||||
Sequence: QSGHRGHSHTPSLEMPPTPIQQM | ||||||
Region | 1470-1494 | Disordered | ||||
Sequence: SDDTSAAAAEEPEAPEEDELLALMD | ||||||
Compositional bias | 1478-1494 | Acidic residues | ||||
Sequence: AEEPEAPEEDELLALMD |
Sequence similarities
Belongs to the ku80 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Length1,494
- Mass (Da)165,095
- Last updated2023-09-13 v1
- Checksum6A023F8383A0453E
Features
Showing features for non-terminal residue, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: T | ||||||
Compositional bias | 148-162 | Basic and acidic residues | ||||
Sequence: MGSESKKRRLSVDMA | ||||||
Compositional bias | 414-438 | Polar residues | ||||
Sequence: PGALPTSNTTAMSASSLSTQQWPER | ||||||
Compositional bias | 463-477 | Basic and acidic residues | ||||
Sequence: HHHRPSSDLTTLHRT | ||||||
Compositional bias | 492-508 | Basic and acidic residues | ||||
Sequence: DIHDPPRHRPYGHSHSR | ||||||
Compositional bias | 1478-1494 | Acidic residues | ||||
Sequence: AEEPEAPEEDELLALMD |
Keywords
- Technical term