A0A9E9KU74 · A0A9E9KU74_9VIRU
- ProteinRNA-directed RNA polymerase L
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids2228 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
RNA-dependent RNA polymerase, which is responsible for the replication and transcription of the viral RNA genome using antigenomic RNA as an intermediate. During transcription, synthesizes subgenomic RNAs and assures their capping by a cap-snatching mechanism, which involves the endonuclease activity cleaving the host capped pre-mRNAs. These short capped RNAs are then used as primers for viral transcription. The 3'-end of subgenomic mRNAs molecules are heterogeneous and not polyadenylated. The replicase function is to direct synthesis of antigenomic and genomic RNA which are encapsidated and non capped. As a consequence of the use of the same enzyme for both transcription and replication, these mechanisms need to be well coordinated. These processes may be regulated by proteins N and Z in a dose-dependent manner.
Catalytic activity
- a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1)
Cofactor
Protein has several cofactor binding sites:
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | host cell cytoplasm | |
Cellular Component | virion component | |
Molecular Function | hydrolase activity | |
Molecular Function | metal ion binding | |
Molecular Function | nucleotide binding | |
Molecular Function | RNA-dependent RNA polymerase activity | |
Biological Process | cap snatching | |
Biological Process | viral RNA genome replication |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRNA-directed RNA polymerase L
- EC number
- Short namesProtein L
Organism names
- Strain
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Negarnaviricota > Polyploviricotina > Ellioviricetes > Bunyavirales > Arenaviridae > Mammarenavirus
Accessions
- Primary accessionA0A9E9KU74
Subcellular Location
Interaction
Subunit
Homomultimer; the oligomeric structure is essential for the polymerase activity.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1177-1373 | RdRp catalytic | ||||
Sequence: IAMRLSVSLAQLSYSLDHSKWGPMMCPFLFLMLIQNIDLKSPSALEGIKSRDLISTLLCWHIHKMVEVPYNVISAMMRSYIKRNLGVMNSDHMTSTEAFIFNEFEIGVVPSHISSVLDMGQGILHNTSDFYGLVTEKFINYCLRLVSDGSVGSYTSSDDQISLFDSELTSLHDKSEEDFLCLLEFHNYLSDMLNKFI |
Sequence similarities
Belongs to the Bunyavirales RNA polymerase family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length2,228
- Mass (Da)255,102
- Last updated2023-05-03 v1
- ChecksumD7B5EBA4C58BA19C