A0A9D5C018 · A0A9D5C018_9LILI
- ProteinSmall nuclear ribonucleoprotein Sm D3
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids132 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | catalytic step 2 spliceosome | |
Cellular Component | commitment complex | |
Cellular Component | cytosol | |
Cellular Component | pICln-Sm protein complex | |
Cellular Component | precatalytic spliceosome | |
Cellular Component | SMN-Sm protein complex | |
Cellular Component | spliceosomal tri-snRNP complex | |
Cellular Component | U1 snRNP | |
Cellular Component | U12-type spliceosomal complex | |
Cellular Component | U2 snRNP | |
Cellular Component | U4 snRNP | |
Cellular Component | U5 snRNP | |
Molecular Function | RNA binding | |
Biological Process | spliceosomal snRNP assembly |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSmall nuclear ribonucleoprotein Sm D3
- Short namesSm-D3
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Dioscoreales > Dioscoreaceae > Dioscorea
Accessions
- Primary accessionA0A9D5C018
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: SMN-mediated assembly into core snRNPs occurs in the cytosol before SMN-mediated transport to the nucleus to be included in spliceosomes.
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 7-79 | Sm | ||||
Sequence: IPVKLLHEAAGHVVTVELKSGELYRGSMIECEDNWNCQLENITYTARDGKVSQLEHVFIRGSKVRFMVIPDML | ||||||
Region | 113-132 | Disordered | ||||
Sequence: AQAAGRGAPPGRGVAPPVRR |
Sequence similarities
Belongs to the snRNP core protein family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length132
- Mass (Da)14,410
- Last updated2023-05-03 v1
- Checksum371B7918F6E820C6
Keywords
- Technical term