A0A978URS3 · A0A978URS3_ZIZJJ
- Proteinmethionine--tRNA ligase
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids599 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
Catalytic activity
- ATP + L-methionine + tRNA(Met) = AMP + diphosphate + L-methionyl-tRNA(Met)
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | aminoacyl-tRNA synthetase multienzyme complex | |
Cellular Component | cytosol | |
Molecular Function | ATP binding | |
Molecular Function | methionine-tRNA ligase activity | |
Biological Process | methionyl-tRNA aminoacylation | |
Biological Process | post-embryonic development | |
Biological Process | reproductive structure development |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namemethionine--tRNA ligase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Rosales > Rhamnaceae > Paliureae > Ziziphus
Accessions
- Primary accessionA0A978URS3
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 24-418 | Methionyl/Leucyl tRNA synthetase | ||||
Sequence: ILITSALPYVNNVPHLGTLIGCVLSADVFSRYCRLRGYNSIYICGTDEYGTATETKAMEENCTPQQICDKYYAIHKEVYDWFDISFDEFGRTSTPQQTEICQSIFKKLMENNWLSERTMQQLHCETCERFLADRLVEGTCPTPDCNYDSARGDQCEKCGRLLNPSELVDPKCKVCQKTPEIRDTNHLFLELPLLKEKLEEYINYMSVAGSWSQNAIQATYAWLKEGLKPRCITRDLKWGVPVPHEKFRDKVFYVWFDAPIGYVSITSCYTTDWERWWKNPEDVELYQFMGKDNVPFHTVMFPSTLIGTGENWTLMKNISVTEYINYESGKFSKSKGVGVFGNDAKDTNIPAEVWRYYLLTNRPEVSDTLFTWADLQAKLNSELLNNLGNFINRVL | ||||||
Domain | 444-576 | Methionyl-tRNA synthetase anticodon-binding | ||||
Sequence: LTKTLAERIGEYIDQYIEAMEKVKLKQALKIGISISSEGNAYLQESQFWKLYKQDQASCAIVVRTSVGLVLSQLGLPLEKKLSLLDENEDLERLRKPWELIPAGHRIGTPEPIFKELADEDVEFFRKKFAGSQ |
Sequence similarities
Belongs to the class-I aminoacyl-tRNA synthetase family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length599
- Mass (Da)68,372
- Last updated2023-02-22 v1
- Checksum1CD83FAE1902ABC0
Keywords
- Technical term