A0A961MSI4 · A0A961MSI4_9RHOB
- ProteintRNA-dihydrouridine(20/20a) synthase
- GenedusA
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids401 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Catalyzes the synthesis of 5,6-dihydrouridine (D), a modified base found in the D-loop of most tRNAs, via the reduction of the C5-C6 double bond in target uridines. Specifically modifies U20 and U20a in tRNAs.
Catalytic activity
- 5,6-dihydrouridine20 in tRNA + NAD+ = uridine20 in tRNA + NADH + H+
- 5,6-dihydrouridine(20a) in tRNA + NAD+ = uridine(20a) in tRNA + NADH + H+
- 5,6-dihydrouridine(20a) in tRNA + NADP+ = uridine(20a) in tRNA + NADPH + H+
Cofactor
Features
Showing features for binding site, site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 87-89 | FMN (UniProtKB | ChEBI) | ||||
Sequence: PML | ||||||
Binding site | 140 | FMN (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Site | 167 | Interacts with tRNA | ||||
Sequence: N | ||||||
Active site | 170 | Proton donor | ||||
Sequence: C | ||||||
Binding site | 209 | FMN (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 241 | FMN (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Site | 253 | Interacts with tRNA; defines subfamily-specific binding signature | ||||
Sequence: K | ||||||
Site | 256 | Interacts with tRNA | ||||
Sequence: R | ||||||
Binding site | 281-283 | FMN (UniProtKB | ChEBI) | ||||
Sequence: NGG | ||||||
Binding site | 304-305 | FMN (UniProtKB | ChEBI) | ||||
Sequence: GR | ||||||
Site | 371 | Interacts with tRNA; defines subfamily-specific binding signature | ||||
Sequence: R | ||||||
Site | 374 | Interacts with tRNA; defines subfamily-specific binding signature | ||||
Sequence: R |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | flavin adenine dinucleotide binding | |
Molecular Function | FMN binding | |
Molecular Function | tRNA binding | |
Molecular Function | tRNA dihydrouridine synthase activity |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nametRNA-dihydrouridine(20/20a) synthase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Pseudomonadota > Alphaproteobacteria > Rhodobacterales > Paracoccaceae
Accessions
- Primary accessionA0A961MSI4
Proteomes
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 85-380 | DUS-like FMN-binding | ||||
Sequence: VAPMLDWTDSICRQVHRRLSRHALLYTEMVTSAALVRGGARHLLRFDPVEHPVALQLGGSDPVELAQAVRMGADEGYSEINLNVGCPSDRVQSGSFGAVLMKSPELVGDCLGAMRAATRAEITVKCRIGVDDQDPEQALPALLDAARGAGVKRVIVHARKAWLQGLSPKENREVPPLDYALVERMLSAYPDLKLCLNGGIATLDQAEDLLSRGFAGVMIGRAAYHQPVDILASADRRIFGQPTTDADPVAVAHDMRPVIAGHLARGGRLIGATRHILGLFAGQPGARAWRRALSEM |
Sequence similarities
Belongs to the Dus family. DusA subfamily.
Family and domain databases
Sequence
- Sequence statusComplete
- Length401
- Mass (Da)43,434
- Last updated2023-02-22 v1
- ChecksumE8C56823092AC91C