A0A922IG56 · A0A922IG56_DERFA
- ProteinHormone-sensitive lipase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids640 (go to sequence)
- Protein existencePredicted
- Annotation score5/5
Function
Catalytic activity
- (9Z)-octadecenoate + 1,2-di-(9Z-octadecenoyl)-glycerol + H+ = 1,2,3-tri-(9Z-octadecenoyl)-glycerol + H2OThis reaction proceeds in the backward direction.
- 1,2,3-tri-(9Z-octadecenoyl)-glycerol + H2O = (9Z)-octadecenoate + di-(9Z)-octadecenoylglycerol + H+This reaction proceeds in the forward direction.
- 1,2-di-(9Z-octadecenoyl)-glycerol + H2O = (9Z)-octadecenoate + (9Z-octadecenoyl)-glycerol + H+This reaction proceeds in the forward direction.
- 1,2-di-(9Z-octadecenoyl)-glycerol + H2O = (9Z)-octadecenoate + 2-(9Z-octadecenoyl)-glycerol + H+This reaction proceeds in the forward direction.
- 1,2-di-(9Z-octadecenoyl)-sn-glycerol + H2O = (9Z)-octadecenoate + (9Z-octadecenoyl)-glycerol + H+This reaction proceeds in the forward direction.
- 1,3-di-(9Z-octadecenoyl)-glycerol + H2O = (9Z)-octadecenoate + 1-(9Z-octadecenoyl)-glycerol + H+This reaction proceeds in the forward direction.
- 1-(9Z-octadecenoyl)-glycerol + H2O = (9Z)-octadecenoate + glycerol + H+This reaction proceeds in the forward direction.
- 1-O-hexadecyl-2-acetyl-sn-glycerol + H2O = 1-O-hexadecyl-sn-glycerol + acetate + H+This reaction proceeds in the forward direction.
- 2,3-di-(9Z)-octadecenoyl-sn-glycerol + H2O = (9Z)-octadecenoate + 2-(9Z-octadecenoyl)-glycerol + H+This reaction proceeds in the forward direction.
- 2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-glycerol + H2O = (5Z,8Z,11Z,14Z)-eicosatetraenoate + glycerol + H+This reaction proceeds in the forward direction.
- 2-(9Z-octadecenoyl)-glycerol + H2O = (9Z)-octadecenoate + glycerol + H+This reaction proceeds in the forward direction.
- all-trans-retinyl hexadecanoate + H2O = all-trans-retinol + H+ + hexadecanoateThis reaction proceeds in the forward direction.
- cholesteryl (9Z-octadecenoate) + H2O = (9Z)-octadecenoate + cholesterol + H+This reaction proceeds in the forward direction.
Pathway
Glycerolipid metabolism; triacylglycerol degradation.
Lipid metabolism.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | caveola | |
Cellular Component | cytosol | |
Cellular Component | lipid droplet | |
Molecular Function | sterol esterase activity | |
Molecular Function | triglyceride lipase activity | |
Biological Process | cholesterol metabolic process | |
Biological Process | triglyceride catabolic process |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHormone-sensitive lipase
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Chelicerata > Arachnida > Acari > Acariformes > Sarcoptiformes > Astigmata > Psoroptidia > Analgoidea > Pyroglyphidae > Dermatophagoidinae > Dermatophagoides
Accessions
- Primary accessionA0A922IG56
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 53-251 | Hormone-sensitive lipase N-terminal | ||||
Sequence: VELIDYIQRIRHDVDLVLQQAPLFDLDDQTQGNGYWTLLIIMIKFGRILSTPDLKKKIGRLPLIHLMQIMVEGLKVGLQLHTPKLKSMQQIDSNGKVDLSLFTDEMDFEGILDLIQSLKVPMNSLHEHFNFCWLGSMSKVMQLFTNFMAIYSTQWKSFKIYNWLSHKARAQMFTNMVLNVNVDCLQSMWNITEFPLVRI | ||||||
Domain | 321-480 | Alpha/beta hydrolase fold-3 | ||||
Sequence: FHLHGGGFISQSPESHACYLVKWVRKLDDIPILSVDYSLSPQVIFPEALQEILDMYLWILSKDPEVEKTFGFLPEKIVFCGDSAGGNFSMAMMLILNQIQKKIAESDEDKQKYRYPNGLFLFYAPLVVATMVSPSRILTSIDGLIPLGTLLNCLGAYLPD |
Family and domain databases
Sequence
- Sequence statusComplete
- Length640
- Mass (Da)74,445
- Last updated2023-02-22 v1
- ChecksumABE2841B9FD74CDB
Keywords
- Technical term