A0A922I488 · A0A922I488_DERFA
- ProteinSuccinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
- GeneSUCLG1
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids338 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and specificity for either ATP or GTP is provided by different beta subunits.
Catalytic activity
- succinate + ATP + CoA = succinyl-CoA + ADP + phosphate
Pathway
Carbohydrate metabolism; tricarboxylic acid cycle; succinate from succinyl-CoA (ligase route): step 1/1.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 56-59 | CoA (UniProtKB | ChEBI) | ||||
Sequence: TGKQ | ||||||
Binding site | 82 | CoA (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 135-137 | CoA (UniProtKB | ChEBI) | ||||
Sequence: ITE | ||||||
Binding site | 199 | substrate; ligand shared with subunit beta | ||||
Sequence: Y | ||||||
Active site | 291 | Tele-phosphohistidine intermediate | ||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion | |
Cellular Component | succinate-CoA ligase complex (ADP-forming) | |
Molecular Function | nucleotide binding | |
Molecular Function | succinate-CoA ligase (ADP-forming) activity | |
Molecular Function | succinate-CoA ligase (GDP-forming) activity | |
Biological Process | tricarboxylic acid cycle |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSuccinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
- EC number
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Chelicerata > Arachnida > Acari > Acariformes > Sarcoptiformes > Astigmata > Psoroptidia > Analgoidea > Pyroglyphidae > Dermatophagoidinae > Dermatophagoides
Accessions
- Primary accessionA0A922I488
Proteomes
Subcellular Location
Interaction
Subunit
Heterodimer of an alpha and a beta subunit. Different beta subunits determine nucleotide specificity. Together with an ATP-specific beta subunit, forms an ADP-forming succinyl-CoA synthetase (A-SCS). Together with a GTP-specific beta subunit forms a GDP-forming succinyl-CoA synthetase (G-SCS).
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 43-139 | CoA-binding | ||||
Sequence: KIGSHTKVICQGFTGKQGTFHSKQAIEYGTKMVGGVSPSKAGQIHLDLPVFKTVKEARDKTGADATVIYVPAPGAASAIMEALDAEIPLIVCITEGI |
Sequence similarities
Belongs to the succinate/malate CoA ligase alpha subunit family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length338
- Mass (Da)35,733
- Last updated2023-02-22 v1
- Checksum1B3F7D0F34939C29
Keywords
- Technical term