A0A922HV49 · A0A922HV49_DERFA
- ProteinFatty acid synthase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids2688 (go to sequence)
- Protein existencePredicted
- Annotation score5/5
Function
function
Fatty acid synthetase is a multifunctional enzyme that catalyzes the de novo biosynthesis of long-chain saturated fatty acids starting from acetyl-CoA and malonyl-CoA in the presence of NADPH. This multifunctional protein contains 7 catalytic activities and a site for the binding of the prosthetic group 4'-phosphopantetheine of the acyl carrier protein ([ACP]) domain.
Catalytic activity
- (2E)-butenoyl-[ACP] + H+ + NADPH = butanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-decenoyl-[ACP] + H+ + NADPH = decanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-dodecenoyl-[ACP] + H+ + NADPH = dodecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-hexadecenoyl-[ACP] + H+ + NADPH = hexadecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-hexenoyl-[ACP] + H+ + NADPH = hexanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- (2E)-octadecenoyl-[ACP] + H+ + NADPH = NADP+ + octadecanoyl-[ACP]This reaction proceeds in the forward direction.
- (2E)-octenoyl-[ACP] + H+ + NADPH = NADP+ + octanoyl-[ACP]This reaction proceeds in the forward direction.
- (2E)-tetradecenoyl-[ACP] + H+ + NADPH = NADP+ + tetradecanoyl-[ACP]This reaction proceeds in the forward direction.
- (3R)-hydroxybutanoyl-[ACP] = (2E)-butenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxydecanoyl-[ACP] = (2E)-decenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxydodecanoyl-[ACP] = (2E)-dodecenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxyhexadecanoyl-[ACP] = (2E)-hexadecenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxyhexanoyl-[ACP] = (2E)-hexenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxyoctadecanoyl-[ACP] = (2E)-octadecenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxyoctanoyl-[ACP] = (2E)-octenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- (3R)-hydroxytetradecanoyl-[ACP] = (2E)-tetradecenoyl-[ACP] + H2OThis reaction proceeds in the forward direction.
- 3-oxobutanoyl-[ACP] + H+ + NADPH = (3R)-hydroxybutanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxodecanoyl-[ACP] + H+ + NADPH = (3R)-hydroxydecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxododecanoyl-[ACP] + H+ + NADPH = (3R)-hydroxydodecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxohexadecanoyl-[ACP] + H+ + NADPH = (3R)-hydroxyhexadecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxohexanoyl-[ACP] + H+ + NADPH = (3R)-hydroxyhexanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxooctadecanoyl-[ACP] + H+ + NADPH = (3R)-hydroxyoctadecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxooctanoyl-[ACP] + H+ + NADPH = (3R)-hydroxyoctanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- 3-oxotetradecanoyl-[ACP] + H+ + NADPH = (3R)-hydroxytetradecanoyl-[ACP] + NADP+This reaction proceeds in the forward direction.
- H+ + hexadecanoyl-[ACP] + malonyl-[ACP] = 3-oxooctadecanoyl-[ACP] + CO2 + holo-[ACP]This reaction proceeds in the forward direction.
- H+ + hexanoyl-[ACP] + malonyl-[ACP] = 3-oxooctanoyl-[ACP] + CO2 + holo-[ACP]This reaction proceeds in the forward direction.
- H+ + malonyl-[ACP] + octanoyl-[ACP] = 3-oxodecanoyl-[ACP] + CO2 + holo-[ACP]This reaction proceeds in the forward direction.
- H+ + malonyl-[ACP] + tetradecanoyl-[ACP] = 3-oxohexadecanoyl-[ACP] + CO2 + holo-[ACP]This reaction proceeds in the forward direction.
- acetyl-[ACP] + H+ + malonyl-[ACP] = 3-oxobutanoyl-[ACP] + CO2 + holo-[ACP]This reaction proceeds in the forward direction.
- butanoyl-[ACP] + H+ + malonyl-[ACP] = 3-oxohexanoyl-[ACP] + CO2 + holo-[ACP]This reaction proceeds in the forward direction.
- decanoyl-[ACP] + H+ + malonyl-[ACP] = 3-oxododecanoyl-[ACP] + CO2 + holo-[ACP]This reaction proceeds in the forward direction.
- dodecanoyl-[ACP] + H+ + malonyl-[ACP] = 3-oxotetradecanoyl-[ACP] + CO2 + holo-[ACP]This reaction proceeds in the forward direction.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 922 | Proton acceptor; for dehydratase activity | ||||
Sequence: H | ||||||
Active site | 1082 | Proton donor; for dehydratase activity | ||||
Sequence: D |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | 3-oxoacyl-[acyl-carrier-protein] synthase activity | |
Molecular Function | fatty acid synthase activity | |
Molecular Function | hydrolase activity | |
Molecular Function | oxidoreductase activity | |
Molecular Function | phosphopantetheine binding | |
Biological Process | fatty acid biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameFatty acid synthase
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Chelicerata > Arachnida > Acari > Acariformes > Sarcoptiformes > Astigmata > Psoroptidia > Analgoidea > Pyroglyphidae > Dermatophagoidinae > Dermatophagoides
Accessions
- Primary accessionA0A922HV49
Proteomes
PTM/Processing
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 14-425 | Ketosynthase family 3 (KS3) | ||||
Sequence: KEDIVISGISGRFPEADNMDEFAQKLFSGEDMVTRDDRRWPVEINDSLGSRTGKLKSLDKFDSSFFSMLTYLSHSMDPVSRIVLETTYEAFHDAGVCPHQIRGSNTGVYFGINTIAQADGLPQDDFNDIFTKEAAFWVYGNSKVLYANRISFLFDFQGPSLVIDTACSASLVALATAMNDIRMGVCDTAVVATGNLVPAPFGNSIYSCVGLLASDGKCKVWDKRADGFVRSETIGAVILQRRSQAKRVYATVLHSKVNSDGFKSVGLFAPYWLRQKDLMVSTYEEAGVDPNDLVYFEAHGTGTNVGDPQEAKAIAEAYCKHREQPLLVGAVKSNLGHSEGSSGLNSVAKIVVAFENKCIPANLHFNEPKQEIYAIVNKQIEPVIKNTKFPNGIVGVNSFGVGGVNAHILLKS | ||||||
Region | 886-1018 | N-terminal hotdog fold | ||||
Sequence: KSFYVKKYPEFHNFSTASDFYVKISVHETDWHFLRDHAVEGKALFPATGYLYLVWRRVANHIGQPWSKTPVHFENVRFHRPTLVSETSDIKFTIRLLQGSGEFLVFEANNLVCTGKATVMDNDNGLEVQDTIE | ||||||
Domain | 886-1165 | PKS/mFAS DH | ||||
Sequence: KSFYVKKYPEFHNFSTASDFYVKISVHETDWHFLRDHAVEGKALFPATGYLYLVWRRVANHIGQPWSKTPVHFENVRFHRPTLVSETSDIKFTIRLLQGSGEFLVFEANNLVCTGKATVMDNDNGLEVQDTIEPAIEEDYKQRHSSEFDYLSTREIYKELRIRGYDYGTKFQGLTEARSDGAIGKVKWDGHFISFMDSMLHISLIALPLRALFVPVGFESVRIDPKVLFGEIERVKQEKKKTEEEEFHLKREFLYFSDKTKENETLEKDFSNRVEGAINK | ||||||
Region | 1033-1165 | C-terminal hotdog fold | ||||
Sequence: FDYLSTREIYKELRIRGYDYGTKFQGLTEARSDGAIGKVKWDGHFISFMDSMLHISLIALPLRALFVPVGFESVRIDPKVLFGEIERVKQEKKKTEEEEFHLKREFLYFSDKTKENETLEKDFSNRVEGAINK | ||||||
Domain | 2288-2365 | Carrier | ||||
Sequence: DNSNQSEDDILDQLCAHLNVDKRSREETIGDAGLDSMTVVEIQQRLERDYEVSLSVADVKRITIGEIKDFRDGKREGL |
Family and domain databases
Sequence
- Sequence statusComplete
- Length2,688
- Mass (Da)304,964
- Last updated2023-02-22 v1
- ChecksumD9EBB74F49BF7704
Keywords
- Technical term