A0A8V8TQ87 · A0A8V8TQ87_HUMAN
- ProteinCalmodulin binding transcription activator 1
- GeneCAMTA1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids1536 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | DNA binding | |
Biological Process | regulation of macromolecule metabolic process | |
Biological Process | regulation of primary metabolic process |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A8V8TQ87
Proteomes
Organism-specific databases
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,379 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Proteomic databases
Interaction
Subunit
May interact with calmodulin.
Family & Domains
Features
Showing features for domain, region, compositional bias, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 63-189 | CG-1 | ||||
Sequence: KCSSLPKERHRWNTNEEIAAYLITFEKHEEWLTTSPKTRPQNGSMILYNRKKVKYRKDGYCWKKRKDGKTTREDHMKLKVQGVENPDIVLVHYLNVPAIEDCGKPCGPILCSINTDKKEWAKWTKEE | ||||||
Region | 259-347 | Disordered | ||||
Sequence: HRIISPKVEPRTGGYGSHSEVQHNDVSEGKHEHSHSKGSSREKRNGKVAKPVLLHQSSTEVSSTNQVEVPDTTQSSPVSISSGLNSDPD | ||||||
Compositional bias | 281-307 | Basic and acidic residues | ||||
Sequence: HNDVSEGKHEHSHSKGSSREKRNGKVA | ||||||
Compositional bias | 313-346 | Polar residues | ||||
Sequence: HQSSTEVSSTNQVEVPDTTQSSPVSISSGLNSDP | ||||||
Region | 966-993 | Disordered | ||||
Sequence: MAEMTGSQQHKQASGGGSSGGGSGSGNG | ||||||
Compositional bias | 967-993 | Polar residues | ||||
Sequence: AEMTGSQQHKQASGGGSSGGGSGSGNG | ||||||
Repeat | 1040-1062 | ANK | ||||
Sequence: RGMTLLHLAAAQGYATLIQTLIK |
Sequence similarities
Belongs to the CAMTA family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,536
- Mass (Da)168,051
- Last updated2022-12-14 v1
- ChecksumD5D9BA76D74EEEBA
Computationally mapped potential isoform sequences
There are 24 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q9Y6Y1 | CMTA1_HUMAN | CAMTA1 | 1673 | ||
H0YJR7 | H0YJR7_HUMAN | CAMTA1 | 239 | ||
H0YJK7 | H0YJK7_HUMAN | CAMTA1 | 33 | ||
H0YJG5 | H0YJG5_HUMAN | CAMTA1 | 39 | ||
H0YJY7 | H0YJY7_HUMAN | CAMTA1 | 60 | ||
H0YJV1 | H0YJV1_HUMAN | CAMTA1 | 73 | ||
G3V297 | G3V297_HUMAN | CAMTA1 | 92 | ||
A0AA34QVU6 | A0AA34QVU6_HUMAN | CAMTA1 | 685 | ||
A0AA34QVZ9 | A0AA34QVZ9_HUMAN | CAMTA1 | 572 | ||
A0A8V8TQA4 | A0A8V8TQA4_HUMAN | CAMTA1 | 577 | ||
A0A8V8TR75 | A0A8V8TR75_HUMAN | CAMTA1 | 58 | ||
A0A8V8TR82 | A0A8V8TR82_HUMAN | CAMTA1 | 690 | ||
A0A8V8TR85 | A0A8V8TR85_HUMAN | CAMTA1 | 235 | ||
A0A8V8TQX1 | A0A8V8TQX1_HUMAN | CAMTA1 | 83 | ||
A0A8V8TQX5 | A0A8V8TQX5_HUMAN | CAMTA1 | 50 | ||
A0A8V8TQX9 | A0A8V8TQX9_HUMAN | CAMTA1 | 591 | ||
A0A8V8TPN7 | A0A8V8TPN7_HUMAN | CAMTA1 | 105 | ||
A0A8V8TPP2 | A0A8V8TPP2_HUMAN | CAMTA1 | 955 | ||
A0A8V8TPQ2 | A0A8V8TPQ2_HUMAN | CAMTA1 | 697 | ||
A0A8V8TPQ7 | A0A8V8TPQ7_HUMAN | CAMTA1 | 145 | ||
A0A8V8TQ65 | A0A8V8TQ65_HUMAN | CAMTA1 | 1537 | ||
A0A8V8TQ84 | A0A8V8TQ84_HUMAN | CAMTA1 | 591 | ||
A0A8V8TQ98 | A0A8V8TQ98_HUMAN | CAMTA1 | 789 | ||
A0A0C4DGL0 | A0A0C4DGL0_HUMAN | CAMTA1 | 1560 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 281-307 | Basic and acidic residues | ||||
Sequence: HNDVSEGKHEHSHSKGSSREKRNGKVA | ||||||
Compositional bias | 313-346 | Polar residues | ||||
Sequence: HQSSTEVSSTNQVEVPDTTQSSPVSISSGLNSDP | ||||||
Compositional bias | 967-993 | Polar residues | ||||
Sequence: AEMTGSQQHKQASGGGSSGGGSGSGNG |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL512330 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL590128 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL683812 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF495826 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF495853 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
Z97635 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
Z97987 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
Z98052 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |