A0A8V8TNG7 · A0A8V8TNG7_HUMAN
- ProteinCF transmembrane conductance regulator
- GeneCFTR
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids478 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Molecular Function | ABC-type transporter activity | |
Molecular Function | ATP binding | |
Molecular Function | chloride channel activity |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A8V8TNG7
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 119-143 | Helical | ||||
Sequence: IAIYLGIGLCLLFIVRTLLLHPAIF | ||||||
Transmembrane | 195-215 | Helical | ||||
Sequence: LALAHFVWIAPLQVALLMGLI | ||||||
Transmembrane | 221-241 | Helical | ||||
Sequence: ASAFCGLGFLIVLALFQAGLG | ||||||
Transmembrane | 304-326 | Helical | ||||
Sequence: YFNSSAFFFSGFFVVFLSVLPYA |
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 842 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Proteomic databases
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 86-323 | ABC transmembrane type-1 | ||||
Sequence: IFLYLGEVTKAVQPLLLGRIIASYDPDNKEERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHFVWIAPLQVALLMGLIWELLQASAFCGLGFLIVLALFQAGLGRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQTELKLTRKAAYVRYFNSSAFFFSGFFVVFLSVL |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length478
- Mass (Da)54,822
- Last updated2022-12-14 v1
- ChecksumE67C78BCC2FB6C33
Computationally mapped potential isoform sequences
There are 19 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
P13569 | CFTR_HUMAN | CFTR | 1480 | ||
C9J6L5 | C9J6L5_HUMAN | CFTR | 36 | ||
E7EPB6 | E7EPB6_HUMAN | CFTR | 1438 | ||
H0Y8A9 | H0Y8A9_HUMAN | CFTR | 190 | ||
M0QYZ3 | M0QYZ3_HUMAN | CFTR | 156 | ||
A0A8V8TPV6 | A0A8V8TPV6_HUMAN | CFTR | 1338 | ||
A0A8V8TQ89 | A0A8V8TQ89_HUMAN | CFTR | 536 | ||
A0A8V8TQ94 | A0A8V8TQ94_HUMAN | CFTR | 564 | ||
A0A8V8TNH2 | A0A8V8TNH2_HUMAN | CFTR | 1478 | ||
A0A8V8TNN0 | A0A8V8TNN0_HUMAN | CFTR | 1428 | ||
A0A8V8TNN7 | A0A8V8TNN7_HUMAN | CFTR | 57 | ||
A0A3B3IT97 | A0A3B3IT97_HUMAN | CFTR | 58 | ||
A0A3B3ITE0 | A0A3B3ITE0_HUMAN | CFTR | 1196 | ||
A0A3B3ITW0 | A0A3B3ITW0_HUMAN | CFTR | 842 | ||
A0A3B3ITW5 | A0A3B3ITW5_HUMAN | CFTR | 1187 | ||
A0A8I5KVV2 | A0A8I5KVV2_HUMAN | CFTR | 1300 | ||
A0A8I5KVL1 | A0A8I5KVL1_HUMAN | CFTR | 1180 | ||
A0A8I5KXQ9 | A0A8I5KXQ9_HUMAN | CFTR | 280 | ||
A0A669KBE8 | A0A669KBE8_HUMAN | CFTR | 333 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC000061 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC000111 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC002465 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC003045 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF458571 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF458574 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KF458577 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |