A0A8U0UW92 · A0A8U0UW92_MUSPF
- ProteinSerine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
- GenePPP2R5C
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids578 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Cellular Component | protein phosphatase type 2A complex | |
Molecular Function | protein phosphatase activator activity | |
Biological Process | signal transduction |
Names & Taxonomy
Protein names
- Recommended nameSerine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Carnivora > Caniformia > Musteloidea > Mustelidae > Mustelinae > Mustela
Accessions
- Primary accessionA0A8U0UW92
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-30 | Basic and acidic residues | ||||
Sequence: MPNKNKKEKESPKAGKSGKSSKEGQDIIDS | ||||||
Region | 1-77 | Disordered | ||||
Sequence: MPNKNKKEKESPKAGKSGKSSKEGQDIIDSEISSRKNSLVATPSTVSSKIKVPVPQPIVKKDKRQNSSRFNASNNRE | ||||||
Compositional bias | 31-51 | Polar residues | ||||
Sequence: EISSRKNSLVATPSTVSSKIK | ||||||
Region | 531-578 | Disordered | ||||
Sequence: EEARQAQKDLKKDRPVVRRKSELPQDRHTKNALEAHCRADELVSQDGR |
Sequence similarities
Belongs to the phosphatase 2A regulatory subunit B56 family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length578
- Mass (Da)67,032
- Last updated2022-10-12 v1
- ChecksumD028D191086C603D
Computationally mapped potential isoform sequences
There are 7 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
M3XUT6 | M3XUT6_MUSPF | PPP2R5C | 524 | ||
A0A8U0MSN3 | A0A8U0MSN3_MUSPF | PPP2R5C | 485 | ||
A0A8U0RUY1 | A0A8U0RUY1_MUSPF | PPP2R5C | 539 | ||
A0A8U0RVJ0 | A0A8U0RVJ0_MUSPF | PPP2R5C | 543 | ||
A0A8U0RUM7 | A0A8U0RUM7_MUSPF | PPP2R5C | 556 | ||
A0A8U0MUI9 | A0A8U0MUI9_MUSPF | PPP2R5C | 499 | ||
A0A8U0RRN2 | A0A8U0RRN2_MUSPF | PPP2R5C | 550 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-30 | Basic and acidic residues | ||||
Sequence: MPNKNKKEKESPKAGKSGKSSKEGQDIIDS | ||||||
Compositional bias | 31-51 | Polar residues | ||||
Sequence: EISSRKNSLVATPSTVSSKIK |
Keywords
- Technical term