A0A8T8WCH6 · A0A8T8WCH6_9EURY
- ProteinKetol-acid reductoisomerase (NADP(+))
- GeneilvC
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids355 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Involved in the biosynthesis of branched-chain amino acids (BCAA). Catalyzes an alkyl-migration followed by a ketol-acid reduction of (S)-2-acetolactate (S2AL) to yield (R)-2,3-dihydroxy-isovalerate. In the isomerase reaction, S2AL is rearranged via a Mg-dependent methyl migration to produce 3-hydroxy-3-methyl-2-ketobutyrate (HMKB). In the reductase reaction, this 2-ketoacid undergoes a metal-dependent reduction by NADPH to yield (R)-2,3-dihydroxy-isovalerate.
Catalytic activity
- (2R)-2,3-dihydroxy-3-methylbutanoate + NADP+ = (2S)-2-acetolactate + H+ + NADPH
Cofactor
Note: Binds 2 magnesium ions per subunit.
Pathway
Amino-acid biosynthesis; L-isoleucine biosynthesis; L-isoleucine from 2-oxobutanoate: step 2/4.
Amino-acid biosynthesis; L-valine biosynthesis; L-valine from pyruvate: step 2/4.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 33-36 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: YGSQ | ||||||
Binding site | 56 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 59 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 61 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Active site | 115 | |||||
Sequence: H | ||||||
Binding site | 141 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 198 | Mg2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 198 | Mg2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 202 | Mg2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 234 | Mg2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 238 | Mg2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 259 | substrate | ||||
Sequence: S |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Molecular Function | ketol-acid reductoisomerase activity | |
Molecular Function | magnesium ion binding | |
Molecular Function | NADP binding | |
Biological Process | isoleucine biosynthetic process | |
Biological Process | valine biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameKetol-acid reductoisomerase (NADP(+))
- EC number
- Short namesKARI
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageArchaea > Euryarchaeota > Stenosarchaea group > Halobacteria > Halobacteriales > Haloferacaceae > Halobaculum
Accessions
- Primary accessionA0A8T8WCH6
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 10-189 | KARI N-terminal Rossmann | ||||
Sequence: TEVYYDEDADRSQIDDKTVAVLGYGSQGHAHAQNLHDSGVDVIVGLREDSSSRAAAESDGLRVETPADAAAEADIVSVLVPDTVQPAVYEEIEDGIEPGDTLQFAHGFNIHYNQIVPKDGVDVTMVAPKSPGHLVRRNYEAGEGTPGLLAVYQNETGEAREEGLAYAHAIGCTRAGVVET | ||||||
Domain | 190-335 | KARI C-terminal knotted | ||||
Sequence: TFREETETDLFGEQAVLCGGVTSLVKQGYETLVDAGYSREMAYFECLNELKLIVDLMYEGGLGEMWDSVSDTAEYGGLVKGDEVVDEHARENMEEVLEAVQDGTFAREWIAENQAGRPSYTQLREAEKNHDIEDVGEDLRALFAWD |
Sequence similarities
Belongs to the ketol-acid reductoisomerase family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length355
- Mass (Da)38,787
- Last updated2022-10-12 v1
- Checksum8F01DB711B5957E0
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CP081958 EMBL· GenBank· DDBJ | QZP37538.1 EMBL· GenBank· DDBJ | Genomic DNA |