A0A8T2PZV3 · A0A8T2PZV3_CERRI
- ProteinAcetyl-CoA carboxylase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1685 (go to sequence)
- Protein existencePredicted
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | acetyl-CoA carboxylase activity | |
Molecular Function | ATP binding | |
Biological Process | fatty acid biosynthetic process |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameAcetyl-CoA carboxylase
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Polypodiopsida > Polypodiidae > Polypodiales > Pteridineae > Pteridaceae > Parkerioideae > Ceratopteris
Accessions
- Primary accessionA0A8T2PZV3
Proteomes
Structure
Family & Domains
Features
Showing features for domain, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 127-201 | Lipoyl-binding | ||||
Sequence: LQNDHDPSRLIAETPCKLLRFLVPDGSHIDPDMPYAEVEVMKMCMPLLCPAAGTIHFKMSEGQAMMAGDLIASLD | ||||||
Domain | 930-1260 | CoA carboxyltransferase N-terminal | ||||
Sequence: PHKPLDAVERKRLIARRNNTIYCYDFPLLFKRALLQAWGSSDKDVLKSTELVFADKPGWGGILVESDRPIATNDVGMIGWIFELNTPEFPMGRKILVVANDATHGAGAFGPKEDYFFKAMADLACEKKLPLIYLAANSGARIGVAEEVRSCFKIEWADKLSPDRGFQYLYLTEEDYERSKYSVNAHELRLESGEVRWVIDDIIGIEDGLGAENLSGSGAIAGAYSRAYKETFTLTYVSGRTVGIGAYLARLGMRCIQRSDQPIILTGYSALNKLLGREVYSSQMQLGGPKIMGVNGVTHLIVNDDLEGVSAILKWLSYVPPYVGGPLPCIE | ||||||
Domain | 1264-1575 | CoA carboxyltransferase C-terminal | ||||
Sequence: PPERLVEYDPENSCDPRAAIRGVQTNGKWISGIFDKDSFVETLDGWAKTVITGRARLGGIPVAIIAVETQTVMQMIPADPGQLDSHERVVPQAGQVWFPDSASKTAQALMDFNKEGLPVFIMANWRGFSGGQRDLFEGILQAGSNIVENLRTYEHPVFVYLPKTGELRGGAWVVIDSKINPEEVEMFADTTAKAGVLEPEGLIEIKFRTKEILECMHRLDPEILKLKRDLQEKVTEDASMSIQRKIQAREKILLPVYKQVAIRFAELHDTAARLEAKGVIKKVVDWSNARSYFYKRLKRRVAEESLIKEAMA | ||||||
Coiled coil | 1651-1678 | |||||
Sequence: LKVLPEALKALLQKVDSAEREVLLQQLQ |
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,685
- Mass (Da)187,782
- Last updated2022-10-12 v1
- ChecksumDEF98A19A5EA9DD4
Computationally mapped potential isoform sequences
There are 9 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8T2Q013 | A0A8T2Q013_CERRI | KP509_39G027900 | 2231 | ||
A0A8T2PZM6 | A0A8T2PZM6_CERRI | KP509_39G027900 | 1886 | ||
A0A8T2PZV2 | A0A8T2PZV2_CERRI | KP509_39G027900 | 1730 | ||
A0A8T2PZS8 | A0A8T2PZS8_CERRI | KP509_39G027900 | 2006 | ||
A0A8T2PZT7 | A0A8T2PZT7_CERRI | KP509_39G027900 | 1848 | ||
A0A8T2PZY4 | A0A8T2PZY4_CERRI | KP509_39G027900 | 2073 | ||
A0A8T2PZ67 | A0A8T2PZ67_CERRI | KP509_39G027900 | 1662 | ||
A0A8T2PZE8 | A0A8T2PZE8_CERRI | KP509_39G027900 | 1966 | ||
A0A8T2Q0D3 | A0A8T2Q0D3_CERRI | KP509_39G027900 | 2214 |
Keywords
- Technical term