A0A8S1C8T9 · A0A8S1C8T9_9INSE
- ProteinAcylglycerol kinase, mitochondrial
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids442 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
Catalytic activity
- 1-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycerol + ATP = 1-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-phosphate + ADP + H+This reaction proceeds in the forward direction.
- 1-(9Z-octadecenoyl)-sn-glycerol + ATP = 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + ADP + H+This reaction proceeds in the forward direction.
- 1-hexadecanoyl-sn-glycerol + ATP = 1-hexadecanoyl-sn-glycero-3-phosphate + ADP + H+This reaction proceeds in the forward direction.
- 2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-glycerol + ATP = 2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-phosphate + ADP + H+This reaction proceeds in the forward direction.
- ATP + N-(hexanoyl)sphing-4-enine = ADP + H+ + N-hexanoylsphing-4-enine 1-phosphateThis reaction proceeds in the forward direction.
- a 1-acyl-sn-glycerol + ATP = a 1-acyl-sn-glycero-3-phosphate + ADP + H+This reaction proceeds in the forward direction.
- a 2-acylglycerol + ATP = a 2-acyl-sn-glycerol 3-phosphate + ADP + H+This reaction proceeds in the forward direction.
Cofactor
Pathway
Lipid metabolism; glycerolipid metabolism.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrial intermembrane space | |
Molecular Function | acylglycerol kinase activity | |
Molecular Function | ATP-dependent diacylglycerol kinase activity | |
Molecular Function | ceramide kinase activity | |
Molecular Function | D-erythro-sphingosine kinase activity | |
Biological Process | ceramide biosynthetic process | |
Biological Process | sphingosine biosynthetic process |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAcylglycerol kinase, mitochondrial
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Palaeoptera > Ephemeroptera > Pisciforma > Baetidae > Cloeon
Accessions
- Primary accessionA0A8S1C8T9
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Peripheral membrane protein
Mitochondrion inner membrane ; Peripheral membrane protein
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 57-198 | DAGKc | ||||
Sequence: ERPKRVTVILNPAANGRKAVKDFEKYCAPLLHLAGLTVSVVNSDNEGQIKGLMDVMDNTDCVVIAGGDGSLSEAVTGFLRRPDANSAAKKLPLGIIPLGATNQVATSIFGKYEKREQFMAEATKAVVEGNTKLVDVMKIEPK |
Sequence similarities
Belongs to the AGK family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length442
- Mass (Da)49,880
- Last updated2022-10-12 v1
- Checksum1CCEE4A2B71461A1
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8S1CLC1 | A0A8S1CLC1_9INSE | CLODIP_2_CD07214 | 394 |
Keywords
- Technical term