A0A8S1B134 · A0A8S1B134_ARCPL
- ProteinProstaglandin reductase 1
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids370 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
Catalytic activity
- (5S,12S)-dihydroxy-(6E,10E,12E,14Z)-eicosatetraenoate + NADP+ = 12-oxo-(5S)-hydroxy-(6E,8E,10E,14Z)-eicosatetraenoate + H+ + NADPHThis reaction proceeds in the forward direction.
- 13,14-dihydro-15-oxo-PGF2alpha + NADP+ = 15-oxoprostaglandin F2alpha + H+ + NADPHThis reaction proceeds in the backward direction.
- 13,14-dihydro-15-oxo-prostaglandin E1 + NADP+ = 15-oxoprostaglandin E1 + H+ + NADPHThis reaction proceeds in the backward direction.
- 13,14-dihydro-15-oxo-prostaglandin F1alpha + NADP+ = 15-oxoprostaglandin F1alpha + H+ + NADPHThis reaction proceeds in the backward direction.
- 20-hydroxy-leukotriene B4 + NADP+ = 12-oxo-20-hydroxy-leukotriene B4 + H+ + NADPHThis reaction proceeds in the forward direction.
- 4-hydroxynonanal + NADP+ = (E)-4-hydroxynon-2-enal + H+ + NADPHThis reaction proceeds in the backward direction.
- 6-trans-leukotriene B4 + NADP+ = 12-oxo-(5S)-hydroxy-(6E,8E,10E,14Z)-eicosatetraenoate + H+ + NADPHThis reaction proceeds in the forward direction.
- NADP+ + nonan-2-one = (3E)-nonen-2-one + H+ + NADPHThis reaction proceeds in the backward direction.
- NADP+ + octanal = (2E)-octenal + H+ + NADPHThis reaction proceeds in the backward direction.
- NADP+ + pentan-2-one = (E)-pent-3-en-2-one + H+ + NADPHThis reaction proceeds in the backward direction.
- decanal + NADP+ = (2E)-decenal + H+ + NADPHThis reaction proceeds in the backward direction.
- dodecanal + NADP+ = (2E)-dodecenal + H+ + NADPHThis reaction proceeds in the backward direction.
- hexanal + NADP+ = (E)-hex-2-enal + H+ + NADPHThis reaction proceeds in the backward direction.
- leukotriene B4 + NADP+ = 12-oxo-leukotriene B4 + H+ + NADPHThis reaction proceeds in the forward direction.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | 15-oxoprostaglandin 13-oxidase activity | |
Molecular Function | 2-alkenal reductase [NAD(P)+] activity | |
Biological Process | prostaglandin metabolic process |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProstaglandin reductase 1
- EC number
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Lepidoptera > Glossata > Ditrysia > Noctuoidea > Erebidae > Arctiinae > Arctia
Accessions
- Primary accessionA0A8S1B134
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Keywords
- PTM
Interaction
Subunit
Monomer or homodimer.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 44-368 | Enoyl reductase (ER) | ||||
Sequence: GDPKRSDFKLVEYELPKLRDGDILVKVEWVSVDPYMRAYNNRYIVPYKEFGYQIGIIQESKNPDYPVGTRIVSHQGWCDYYVMNPDIKTGQYDFGLVDFGHYKLPDLQGLPISYGIGVIGMPGATAYFGLLEICKPKAGETVVVTTAAGGVGSIVGQIAKIMGCRVIGFTRNDEKVQWLEKGLGFDRAFNYQTVDVTAALKNAAPDGVDCYFDNVGGDLSFLIMNQMNTCGRVAICGSACSYNDDPSKMTQTTILQPLILSKQLKVEGFVVFRWSERWPEAFEQLIKWIKSGQLKVREQITEGLDNVFDAFYSMLSGKNFGKAVV |
Sequence similarities
Belongs to the NADP-dependent oxidoreductase L4BD family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length370
- Mass (Da)41,409
- Last updated2022-10-12 v1
- Checksum1D4E22288737B994