A0A8M9PZL4 · A0A8M9PZL4_DANRE
- Proteindynamin GTPase
- Genednm2a
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids874 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | microtubule | |
Cellular Component | plasma membrane | |
Cellular Component | presynapse | |
Cellular Component | synapse | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Molecular Function | microtubule binding | |
Biological Process | chordate embryonic development | |
Biological Process | convergent extension | |
Biological Process | muscle structure development | |
Biological Process | receptor internalization | |
Biological Process | somite development | |
Biological Process | synaptic vesicle budding from presynaptic endocytic zone membrane |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namedynamin GTPase
- EC number
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionA0A8M9PZL4
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 28-294 | Dynamin-type G | ||||
Sequence: NLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLVNNKAEYAEFLHCKGRKFVDFDEVRQEIEAETDRITGSNKGISPIPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPPDIEHQIRDMIMQFITRESCLILAVTPANMDLANSDALKVAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDIRAALAAERKFFLSHPSYRHMAERMGTPHLQKALNQQLTNHIRDTLP | ||||||
Domain | 532-637 | PH | ||||
Sequence: QVIRKGWLTLNISIMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKLRDVEKGFMSTKHIFAIFNTEQRNVYKDLRQIELACDSQEDMDSWKASFLRAGV | ||||||
Domain | 665-756 | GED | ||||
Sequence: VETIRNLVDSYIGIVNKTIRDLMPKTIMHLMINSAKDFIHSELLAYLYSSGDQNSLMEESADQAQRRDEMLRMYHAIKEALSIIGDISTSTI | ||||||
Region | 753-874 | Disordered | ||||
Sequence: TSTISTPVPPPVNDSWIPETSPTPQRRPPTSAPPPNRPPAVRGPTPGPPPLNPTPSFAAPPIPSRPGQPMNAFGNSSQDPFSAPPQIPSRPARIPPGVPSRRPPGAPNRPTIIRPAEPSLLD | ||||||
Compositional bias | 763-819 | Pro residues | ||||
Sequence: PVNDSWIPETSPTPQRRPPTSAPPPNRPPAVRGPTPGPPPLNPTPSFAAPPIPSRPG | ||||||
Compositional bias | 821-835 | Polar residues | ||||
Sequence: PMNAFGNSSQDPFSA | ||||||
Compositional bias | 836-863 | Pro residues | ||||
Sequence: PPQIPSRPARIPPGVPSRRPPGAPNRPT |
Sequence similarities
Belongs to the TRAFAC class dynamin-like GTPase superfamily. Dynamin/Fzo/YdjA family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length874
- Mass (Da)98,509
- Last updated2022-08-03 v1
- ChecksumDDEF0966BF8A3724
Computationally mapped potential isoform sequences
There are 8 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M9PHT6 | A0A8M9PHT6_DANRE | dnm2a | 885 | ||
A0A8M9PNW1 | A0A8M9PNW1_DANRE | dnm2a | 878 | ||
T1SXK0 | T1SXK0_DANRE | dnm2a | 856 | ||
A0A8M9P798 | A0A8M9P798_DANRE | dnm2a | 867 | ||
A0A8M9PW32 | A0A8M9PW32_DANRE | dnm2a | 860 | ||
Q4V8Z7 | Q4V8Z7_DANRE | dnm2a | 755 | ||
A0A0R4IIR1 | A0A0R4IIR1_DANRE | dnm2a | 860 | ||
A0A8M9PHU4 | A0A8M9PHU4_DANRE | dnm2a | 856 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 763-819 | Pro residues | ||||
Sequence: PVNDSWIPETSPTPQRRPPTSAPPPNRPPAVRGPTPGPPPLNPTPSFAAPPIPSRPG | ||||||
Compositional bias | 821-835 | Polar residues | ||||
Sequence: PMNAFGNSSQDPFSA | ||||||
Compositional bias | 836-863 | Pro residues | ||||
Sequence: PPQIPSRPARIPPGVPSRRPPGAPNRPT |
Keywords
- Technical term