A0A8M6Z852 · A0A8M6Z852_DANRE
- ProteinNebulin isoform X11
- Geneneb
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids6233 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Z disc | |
Molecular Function | actin filament binding | |
Biological Process | cardiac muscle thin filament assembly | |
Biological Process | muscle cell development | |
Biological Process | regulation of sarcomere organization |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionA0A8M6Z852
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-24 | Disordered | ||||
Sequence: MASEEEYDDDVVEEPGPGGLPRCS | ||||||
Region | 6101-6124 | Disordered | ||||
Sequence: QRRSKEHSRSTSAMSGVGDEKSEV | ||||||
Domain | 6174-6233 | SH3 | ||||
Sequence: TTGKTVRAMYDYAAADSDEVSFKDGDVIVNVQSIDEGWMYGTVQRTGKTGMLPANYVEAI |
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length6,233
- Mass (Da)716,660
- Last updated2022-08-03 v1
- ChecksumC8D9D025AE38B282
Computationally mapped potential isoform sequences
There are 40 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M3B5M2 | A0A8M3B5M2_DANRE | neb | 6307 | ||
A0A8M6Z8K2 | A0A8M6Z8K2_DANRE | neb | 6272 | ||
A0A8M6Z8K7 | A0A8M6Z8K7_DANRE | neb | 6148 | ||
A0A8M6Z8L2 | A0A8M6Z8L2_DANRE | neb | 6043 | ||
A0A8M6Z848 | A0A8M6Z848_DANRE | neb | 6277 | ||
A0A8M6Z857 | A0A8M6Z857_DANRE | neb | 6074 | ||
A0A8M6Z861 | A0A8M6Z861_DANRE | neb | 5978 | ||
A0A8M9PSQ6 | A0A8M9PSQ6_DANRE | neb | 6270 | ||
A0A8M9PSR3 | A0A8M9PSR3_DANRE | neb | 5578 | ||
A0A8M9Q4L7 | A0A8M9Q4L7_DANRE | neb | 6264 | ||
A0A8M9Q4M0 | A0A8M9Q4M0_DANRE | neb | 6227 | ||
A0A8M9Q4M9 | A0A8M9Q4M9_DANRE | neb | 6074 | ||
A0A8M9Q4N2 | A0A8M9Q4N2_DANRE | neb | 5535 | ||
A0A8M9Q504 | A0A8M9Q504_DANRE | neb | 5578 | ||
A0A8M9Q4Z7 | A0A8M9Q4Z7_DANRE | neb | 6235 | ||
A0A8M9PS34 | A0A8M9PS34_DANRE | neb | 6234 | ||
A0A8M9PS40 | A0A8M9PS40_DANRE | neb | 6202 | ||
A0A8M9PS57 | A0A8M9PS57_DANRE | neb | 6021 | ||
A0A8M9PY67 | A0A8M9PY67_DANRE | neb | 6233 | ||
A0A8M9PY72 | A0A8M9PY72_DANRE | neb | 6192 | ||
A0A8M9PY77 | A0A8M9PY77_DANRE | neb | 6117 | ||
A0A8M9PY88 | A0A8M9PY88_DANRE | neb | 6008 | ||
A0A8M9Q965 | A0A8M9Q965_DANRE | neb | 6229 | ||
A0A8M9Q969 | A0A8M9Q969_DANRE | neb | 6190 | ||
A0A8M3B2N0 | A0A8M3B2N0_DANRE | neb | 4026 | ||
A0A8M9QBA5 | A0A8M9QBA5_DANRE | neb | 5335 | ||
A0A8M6Z2P4 | A0A8M6Z2P4_DANRE | neb | 6276 | ||
A0A8M6Z124 | A0A8M6Z124_DANRE | neb | 6198 | ||
A0A8M6Z118 | A0A8M6Z118_DANRE | neb | 6276 | ||
A0A8M9QFX3 | A0A8M9QFX3_DANRE | neb | 6276 | ||
A0A8M6Z0E1 | A0A8M6Z0E1_DANRE | neb | 6306 | ||
A0A8M6Z0E9 | A0A8M6Z0E9_DANRE | neb | 6245 | ||
A0A8M9QK40 | A0A8M9QK40_DANRE | neb | 3409 | ||
A0A8M9QK37 | A0A8M9QK37_DANRE | neb | 6112 | ||
A0A8M6Z2Q0 | A0A8M6Z2Q0_DANRE | neb | 6183 | ||
A0A8M6Z2Q5 | A0A8M6Z2Q5_DANRE | neb | 6064 | ||
A0A8M9PF78 | A0A8M9PF78_DANRE | neb | 6263 | ||
A0A8M9PF84 | A0A8M9PF84_DANRE | neb | 6214 | ||
A0A8M9PF90 | A0A8M9PF90_DANRE | neb | 6155 | ||
A0A8M9PFA7 | A0A8M9PFA7_DANRE | neb | 5535 |
Keywords
- Technical term