A0A8M6Z6Z1 · A0A8M6Z6Z1_DANRE
- ProteinMyocyte-specific enhancer factor 2C isoform X2
- Genemef2cb
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids480 (go to sequence)
- Protein existencePredicted
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | histone deacetylase binding | |
Molecular Function | protein dimerization activity | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Biological Process | cardiac muscle cell development | |
Biological Process | cardiac muscle cell differentiation | |
Biological Process | cell differentiation | |
Biological Process | DNA-templated transcription | |
Biological Process | embryonic heart tube morphogenesis | |
Biological Process | heart development | |
Biological Process | heart formation | |
Biological Process | positive regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionA0A8M6Z6Z1
Proteomes
Organism-specific databases
Subcellular Location
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-61 | MADS-box | ||||
Sequence: MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTD | ||||||
Compositional bias | 377-437 | Polar residues | ||||
Sequence: STQSLHIKSEPVSPPRDRSSSTTPGGYGQLPSHQQHQGPTSQGRQDSGRSPADSLSSCGSS | ||||||
Region | 377-480 | Disordered | ||||
Sequence: STQSLHIKSEPVSPPRDRSSSTTPGGYGQLPSHQQHQGPTSQGRQDSGRSPADSLSSCGSSHEGSDRDEHRPDFHSPLGLGRPGLDDQDSPSIKRIRLSEGWAT | ||||||
Compositional bias | 438-452 | Basic and acidic residues | ||||
Sequence: HEGSDRDEHRPDFHS |
Family and domain databases
Sequence
- Sequence statusComplete
- Length480
- Mass (Da)51,898
- Last updated2022-08-03 v1
- Checksum7B84F3BE8E2A1599
Computationally mapped potential isoform sequences
There are 9 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M3B2S1 | A0A8M3B2S1_DANRE | mef2cb | 483 | ||
A0A2R8QP40 | A0A2R8QP40_DANRE | mef2cb | 472 | ||
F1QNL1 | F1QNL1_DANRE | mef2cb | 475 | ||
A0A8M3ASR6 | A0A8M3ASR6_DANRE | mef2cb | 463 | ||
A0A8M3ASM1 | A0A8M3ASM1_DANRE | mef2cb | 471 | ||
A0A8M3B9V7 | A0A8M3B9V7_DANRE | mef2cb | 483 | ||
A2BGA7 | A2BGA7_DANRE | mef2cb | 474 | ||
A0A8M6Z0P2 | A0A8M6Z0P2_DANRE | mef2cb | 466 | ||
B5A8L9 | B5A8L9_DANRE | mef2cb | 475 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 377-437 | Polar residues | ||||
Sequence: STQSLHIKSEPVSPPRDRSSSTTPGGYGQLPSHQQHQGPTSQGRQDSGRSPADSLSSCGSS | ||||||
Compositional bias | 438-452 | Basic and acidic residues | ||||
Sequence: HEGSDRDEHRPDFHS |
Keywords
- Technical term