A0A8M3AZ17 · A0A8M3AZ17_DANRE
- ProteinEyes absent homolog
- Geneeya1
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids592 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
Catalytic activity
- H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
Cofactor
Note: Binds 1 Mg2+ ion per subunit.
Features
Showing features for active site, binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | metal ion binding | |
Molecular Function | protein tyrosine phosphatase activity | |
Biological Process | adenohypophysis development | |
Biological Process | cell differentiation | |
Biological Process | ear morphogenesis | |
Biological Process | inner ear morphogenesis | |
Biological Process | negative regulation of extrinsic apoptotic signaling pathway in absence of ligand | |
Biological Process | otic vesicle morphogenesis | |
Biological Process | otolith development | |
Biological Process | positive regulation of DNA repair |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameEyes absent homolog
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionA0A8M3AZ17
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-55 | Disordered | ||||
Sequence: MEMQDLASPHSRVSGSSESPNGPNIDNSHINNNSMTPNGTEVKTEPMSSSEIATS | ||||||
Compositional bias | 9-55 | Polar residues | ||||
Sequence: PHSRVSGSSESPNGPNIDNSHINNNSMTPNGTEVKTEPMSSSEIATS | ||||||
Compositional bias | 67-88 | Polar residues | ||||
Sequence: SAIGTSGFSPRQTHQFSPQIYP | ||||||
Region | 67-91 | Disordered | ||||
Sequence: SAIGTSGFSPRQTHQFSPQIYPSNR | ||||||
Compositional bias | 237-286 | Polar residues | ||||
Sequence: PYMTSNNTSPTTPSTTATYTLQEPPSGITSQALTEQPTGEYSTIHSPSTP | ||||||
Region | 237-321 | Disordered | ||||
Sequence: PYMTSNNTSPTTPSTTATYTLQEPPSGITSQALTEQPTGEYSTIHSPSTPIKDSDSDRLRRASDVKARGRGRRNNNPSPPPDSDL | ||||||
Compositional bias | 287-307 | Basic and acidic residues | ||||
Sequence: IKDSDSDRLRRASDVKARGRG |
Sequence similarities
Belongs to the HAD-like hydrolase superfamily. EYA family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length592
- Mass (Da)64,759
- Last updated2022-08-03 v1
- Checksum7C329AABF4823141
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M6YVK2 | A0A8M6YVK2_DANRE | eya1 | 614 | ||
Q9W6E8 | Q9W6E8_DANRE | eya1 | 609 | ||
A0A8M3AP55 | A0A8M3AP55_DANRE | eya1 | 613 | ||
A0A8M2B9H5 | A0A8M2B9H5_DANRE | eya1 | 586 | ||
Q6DBY3 | Q6DBY3_DANRE | eya1 | 587 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 9-55 | Polar residues | ||||
Sequence: PHSRVSGSSESPNGPNIDNSHINNNSMTPNGTEVKTEPMSSSEIATS | ||||||
Compositional bias | 67-88 | Polar residues | ||||
Sequence: SAIGTSGFSPRQTHQFSPQIYP | ||||||
Compositional bias | 237-286 | Polar residues | ||||
Sequence: PYMTSNNTSPTTPSTTATYTLQEPPSGITSQALTEQPTGEYSTIHSPSTP | ||||||
Compositional bias | 287-307 | Basic and acidic residues | ||||
Sequence: IKDSDSDRLRRASDVKARGRG |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX510326 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CR450806 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CT573498 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |