A0A8M3AYX5 · A0A8M3AYX5_DANRE
- ProteinDynactin subunit 1
- Genedctn1b
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1258 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axon | |
Cellular Component | dynein complex | |
Cellular Component | kinetochore | |
Cellular Component | microtubule associated complex | |
Cellular Component | spindle pole | |
Biological Process | camera-type eye photoreceptor cell differentiation | |
Biological Process | establishment of mitotic spindle orientation | |
Biological Process | nuclear migration |
Names & Taxonomy
Protein names
- Recommended nameDynactin subunit 1
Gene names
Organism names
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Actinopterygii (ray-finned fishes) > Actinopteri > Neopterygii > Teleostei (teleost fishes) > Osteoglossocephalai > Clupeocephala > Otomorpha > Ostariophysi > Otophysi > Cypriniphysae > Cypriniformes (carps and others) > Cyprinoidei > Danionidae > Danioninae > Danio
Accessions
- Primary accessionA0A8M3AYX5
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-22 | Polar residues | ||||
Sequence: MSQMKRYTYSRTTSSGSSRMSS | ||||||
Region | 1-28 | Disordered | ||||
Sequence: MSQMKRYTYSRTTSSGSSRMSSDGGGRP | ||||||
Domain | 50-92 | CAP-Gly | ||||
Sequence: GNTLFASGKWVGVILDEPKGKNDGTVQGKRYFLCQENHGIFVR | ||||||
Region | 131-209 | Disordered | ||||
Sequence: KVRGTKPKKTTTRRPKQTRAGVGVKVGSGSASAGEMSSSEPSTPAQTPLAAPVIPSPVGALPSPGAPPIPGPSKEEESL | ||||||
Compositional bias | 161-176 | Polar residues | ||||
Sequence: ASAGEMSSSEPSTPAQ | ||||||
Compositional bias | 178-201 | Pro residues | ||||
Sequence: PLAAPVIPSPVGALPSPGAPPIPG | ||||||
Coiled coil | 940-1031 | |||||
Sequence: IKELKKSLKIKGEELSEANVRLSLLEKKLDSASKDADERVEKIQAILDETDSLLKKKEKEFEETMDALQADIDQLESEKVELKHRISSQSKM | ||||||
Coiled coil | 1078-1105 | |||||
Sequence: IEAQRLSIKHLKNENNRLKAERMRAQLA | ||||||
Coiled coil | 1165-1192 | |||||
Sequence: LLEQTARLQSLNDTLDRLKDEVAEHVVT |
Sequence similarities
Belongs to the dynactin 150 kDa subunit family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,258
- Mass (Da)140,502
- Last updated2022-08-03 v1
- ChecksumCFF54CB040BD2926
Computationally mapped potential isoform sequences
There are 6 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M9QFT7 | A0A8M9QFT7_DANRE | dctn1b | 1264 | ||
A0A8M3BEJ1 | A0A8M3BEJ1_DANRE | dctn1b | 1260 | ||
A0A8M9QNN7 | A0A8M9QNN7_DANRE | dctn1b | 1263 | ||
A0A8M3B541 | A0A8M3B541_DANRE | dctn1b | 1245 | ||
A0A8M3B7W5 | A0A8M3B7W5_DANRE | dctn1b | 1251 | ||
A0A8M9QK32 | A0A8M9QK32_DANRE | dctn1b | 1257 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-22 | Polar residues | ||||
Sequence: MSQMKRYTYSRTTSSGSSRMSS | ||||||
Compositional bias | 161-176 | Polar residues | ||||
Sequence: ASAGEMSSSEPSTPAQ | ||||||
Compositional bias | 178-201 | Pro residues | ||||
Sequence: PLAAPVIPSPVGALPSPGAPPIPG |
Keywords
- Technical term