A0A8M2BL09 · A0A8M2BL09_DANRE
- ProteinSeptin
- Geneseptin6
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids432 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell division site | |
Cellular Component | cilium | |
Cellular Component | microtubule cytoskeleton | |
Cellular Component | septin complex | |
Cellular Component | septin ring | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Molecular Function | molecular adaptor activity | |
Biological Process | cilium assembly | |
Biological Process | cytoskeleton-dependent cytokinesis | |
Biological Process | determination of digestive tract left/right asymmetry | |
Biological Process | determination of heart left/right asymmetry | |
Biological Process | determination of left/right asymmetry in lateral mesoderm | |
Biological Process | determination of left/right symmetry | |
Biological Process | determination of liver left/right asymmetry | |
Biological Process | determination of pancreatic left/right asymmetry | |
Biological Process | protein localization |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameSeptin
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionA0A8M2BL09
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, coiled coil, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 44-310 | Septin-type G | ||||
Sequence: HGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPTQHNQPGVQLKSNTYELQESNVRLKLTVVNTVGFGDQINKEDSYKSIVEFIDAQFEAYLQEELKIKRTLHSYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKSDAISKSELAKFKIKITSELVSNGVQIYQFPTDDETVAEINSTMNGHLPFAVVGSTEEVKIGNKMVRARQYPWGTVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEE | ||||||
Region | 54-61 | G1 motif | ||||
Sequence: GETGLGKS | ||||||
Region | 106-109 | G3 motif | ||||
Sequence: NTVG | ||||||
Region | 189-192 | G4 motif | ||||
Sequence: AKSD | ||||||
Coiled coil | 326-404 | |||||
Sequence: QETYEAKRNEFMGELQKKEEEMRQMFVQRVKEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDELNGFKQK | ||||||
Region | 405-432 | Disordered | ||||
Sequence: KTAAELLQSQNQQPGGSATLKKDKERKN | ||||||
Compositional bias | 406-422 | Polar residues | ||||
Sequence: TAAELLQSQNQQPGGSA |
Sequence similarities
Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. Septin GTPase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length432
- Mass (Da)49,601
- Last updated2022-08-03 v1
- ChecksumDE221CEEA9B3A644
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M2BKJ6 | A0A8M2BKJ6_DANRE | septin6 | 436 | ||
A0A8M2BKJ7 | A0A8M2BKJ7_DANRE | septin6 | 434 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 406-422 | Polar residues | ||||
Sequence: TAAELLQSQNQQPGGSA |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX571981 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |