A0A8M1P4D6 · A0A8M1P4D6_DANRE
- ProteinGamma-aminobutyric acid receptor subunit gamma-2
- Genegabrg2
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids476 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloride channel complex | |
Cellular Component | dendrite membrane | |
Cellular Component | GABA-A receptor complex | |
Cellular Component | neuron projection | |
Cellular Component | plasma membrane | |
Cellular Component | postsynapse | |
Cellular Component | synapse | |
Cellular Component | transmembrane transporter complex | |
Molecular Function | chloride channel activity | |
Molecular Function | extracellular ligand-gated monoatomic ion channel activity | |
Molecular Function | GABA-A receptor activity | |
Molecular Function | neurotransmitter receptor activity | |
Biological Process | chloride transmembrane transport | |
Biological Process | gamma-aminobutyric acid signaling pathway | |
Biological Process | inhibitory synapse assembly | |
Biological Process | protein heterotrimerization | |
Biological Process | regulation of postsynaptic membrane potential | |
Biological Process | synaptic transmission, GABAergic |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionA0A8M1P4D6
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 272-295 | Helical | ||||
Sequence: MGYFTIQTYIPCTLIVVLSWVSFW | ||||||
Transmembrane | 307-326 | Helical | ||||
Sequence: LGITTVLTMTTLSTIARKSL | ||||||
Transmembrane | 338-360 | Helical | ||||
Sequence: FVSVCFIFVFAALIEYGTLHYFV | ||||||
Transmembrane | 456-475 | Helical | ||||
Sequence: IFFPTAFGLFNVVYWFSYLY |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Disulfide bond | 190↔204 | |||||
Sequence: CQLKLNNFPMDEHSC |
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 67-272 | Neurotransmitter-gated ion-channel ligand-binding | ||||
Sequence: THILNSLLDGYDNKLRPDIGVKPTVIHTDMFVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTMKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRILYTLRLTIDAECQLKLNNFPMDEHSCPLEFSSYGYPKEEIVYKWKRSSVEVGDIRSWRLYQFSFVGLRNTSEVVRTVSGDYVVLTVFFDLSRRM | ||||||
Domain | 279-470 | Neurotransmitter-gated ion-channel transmembrane | ||||
Sequence: TYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALIEYGTLHYFVSNRKPSKKSDKKKKNPLLRLFSSKAPTVDIRPRSATAIQMNNATQMQERDEEYGYECLDGKDCTSFFCCFEDCRSGAWRHGRLHIRVAKIDSYARIFFPTAFGLFNVVYW |
Sequence similarities
Belongs to the ligand-gated ion channel (TC 1.A.9) family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length476
- Mass (Da)55,056
- Last updated2022-08-03 v1
- Checksum41FA4B36E7CE9DAD
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F1RDP2 | F1RDP2_DANRE | gabrg2 | 477 | ||
A0A2R8Q1Q9 | A0A2R8Q1Q9_DANRE | gabrg2 | 469 | ||
A0A8M2B8H9 | A0A8M2B8H9_DANRE | gabrg2 | 468 |
Keywords
- Technical term