A0A8J0PPU8 · A0A8J0PPU8_XENLA
- ProteinEukaryotic translation initiation factor 3 subunit A
- Geneeif3a.L
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1370 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | eukaryotic 43S preinitiation complex | |
Cellular Component | eukaryotic 48S preinitiation complex | |
Cellular Component | eukaryotic translation initiation factor 3 complex | |
Molecular Function | RNA binding | |
Molecular Function | translation initiation factor activity | |
Biological Process | formation of cytoplasmic translation initiation complex |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameEukaryotic translation initiation factor 3 subunit A
- Short nameseIF3a
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Pipoidea > Pipidae > Xenopodinae > Xenopus > Xenopus
Accessions
- Primary accessionA0A8J0PPU8
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for initiator methionine.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M |
Interaction
Subunit
Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is composed of 13 subunits: EIF3A, EIF3B, EIF3C, EIF3D, EIF3E, EIF3F, EIF3G, EIF3H, EIF3I, EIF3J, EIF3K, EIF3L and EIF3M.
Structure
Family & Domains
Features
Showing features for domain, coiled coil, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 315-498 | PCI | ||||
Sequence: MQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLGLQSPPNRAGLIKDMVRFNVMQYILPEVKELYNWLEVDFHPLKLCDRVTKVLDWIKEQAEKEPELQQYVPQLQSNTVLRLLQQVAQIYQTIEFSRLASLLPFVDAFLLERAIVDAARHCNLQVRIDHTSRTLSFGSDLN | ||||||
Coiled coil | 565-634 | |||||
Sequence: HQRILARRQTIEERKERLENLNIQREKEEHEQREAELQKVRKAEEERLRQEAKEREKERILQEHEQIKKK | ||||||
Coiled coil | 670-701 | |||||
Sequence: MAKQVEQLEKEKRELQDRLKNQEKKIDYFERA | ||||||
Compositional bias | 811-913 | Basic and acidic residues | ||||
Sequence: EEEEQRLKEEQLKQEQEEREKIENEKREAEQREYQERIKKLEEQERKKRQRELEIEERERKREEERRGGDDTLRKDTSRWGEREESGWRRGEEPDERKQAPPE | ||||||
Region | 811-1370 | Disordered | ||||
Sequence: EEEEQRLKEEQLKQEQEEREKIENEKREAEQREYQERIKKLEEQERKKRQRELEIEERERKREEERRGGDDTLRKDTSRWGEREESGWRRGEEPDERKQAPPESIWRRAGQDSKPVRDEDHEADEDASLRKDEEQVSRPDGEEEKGGSWRGTDDRGPKRGLEEDRGPRRGFEDDRGPRRGLDDDRGPRRGLDDDRVPRRGLDDDRGPRRGIDDDRAPRRGFDEDRGPRRGIDDDSGPRRGFDDDRGPRRGFDDDRGPRRGFDDDRGPRRGFDDDRGPRRGFDDDRGPRRGFEDDRVPRRGFEDDRGPRRGFEEDRGPRRGFDEDRGPRRGFEDDRAPRRGFDEDRTPSRGFDDDRGSWRGAADEDRGPRRGAADEDRGPRRGADEDRGPRRGADEDRGQTPWKPIVASRPGGWREREKAREDSWGPPHESKPAEERSWAKRGEESEKDSERDKHPVREESVWRRGGDDNVTPRKVSPGDKSTDDKTEPRDRRRVPPKTDEASPWRRDEEKESRQEERGTPRGAPAVDREKPSWNTEKEEKDAPRRTKLETDEDGWTTVRR | ||||||
Compositional bias | 920-1208 | Basic and acidic residues | ||||
Sequence: GQDSKPVRDEDHEADEDASLRKDEEQVSRPDGEEEKGGSWRGTDDRGPKRGLEEDRGPRRGFEDDRGPRRGLDDDRGPRRGLDDDRVPRRGLDDDRGPRRGIDDDRAPRRGFDEDRGPRRGIDDDSGPRRGFDDDRGPRRGFDDDRGPRRGFDDDRGPRRGFDDDRGPRRGFDDDRGPRRGFEDDRVPRRGFEDDRGPRRGFEEDRGPRRGFDEDRGPRRGFEDDRAPRRGFDEDRTPSRGFDDDRGSWRGAADEDRGPRRGAADEDRGPRRGADEDRGPRRGADEDRG | ||||||
Compositional bias | 1220-1370 | Basic and acidic residues | ||||
Sequence: PGGWREREKAREDSWGPPHESKPAEERSWAKRGEESEKDSERDKHPVREESVWRRGGDDNVTPRKVSPGDKSTDDKTEPRDRRRVPPKTDEASPWRRDEEKESRQEERGTPRGAPAVDREKPSWNTEKEEKDAPRRTKLETDEDGWTTVRR |
Sequence similarities
Belongs to the eIF-3 subunit A family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,370
- Mass (Da)162,297
- Last updated2022-05-25 v1
- Checksum8B10BC569E6FBB1C
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1L8FIA3 | A0A1L8FIA3_XENLA | eif3a.L | 1390 | ||
A0A8J1L424 | A0A8J1L424_XENLA | eif3a.L | 1359 | ||
A0A8J1L5S4 | A0A8J1L5S4_XENLA | eif3a.L | 1380 | ||
A0A8J1L6T2 | A0A8J1L6T2_XENLA | eif3a.L | 1379 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 811-913 | Basic and acidic residues | ||||
Sequence: EEEEQRLKEEQLKQEQEEREKIENEKREAEQREYQERIKKLEEQERKKRQRELEIEERERKREEERRGGDDTLRKDTSRWGEREESGWRRGEEPDERKQAPPE | ||||||
Compositional bias | 920-1208 | Basic and acidic residues | ||||
Sequence: GQDSKPVRDEDHEADEDASLRKDEEQVSRPDGEEEKGGSWRGTDDRGPKRGLEEDRGPRRGFEDDRGPRRGLDDDRGPRRGLDDDRVPRRGLDDDRGPRRGIDDDRAPRRGFDEDRGPRRGIDDDSGPRRGFDDDRGPRRGFDDDRGPRRGFDDDRGPRRGFDDDRGPRRGFDDDRGPRRGFEDDRVPRRGFEDDRGPRRGFEEDRGPRRGFDEDRGPRRGFEDDRAPRRGFDEDRTPSRGFDDDRGSWRGAADEDRGPRRGAADEDRGPRRGADEDRGPRRGADEDRG | ||||||
Compositional bias | 1220-1370 | Basic and acidic residues | ||||
Sequence: PGGWREREKAREDSWGPPHESKPAEERSWAKRGEESEKDSERDKHPVREESVWRRGGDDNVTPRKVSPGDKSTDDKTEPRDRRRVPPKTDEASPWRRDEEKESRQEERGTPRGAPAVDREKPSWNTEKEEKDAPRRTKLETDEDGWTTVRR |
Keywords
- Technical term