A0A8I5KZ03 · A0A8I5KZ03_HUMAN
- ProteinIntraflagellar transport protein 122 homolog
- GeneIFT122
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids249 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score1/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Biological Process | cilium assembly |
Names & Taxonomy
Protein names
- Recommended nameIntraflagellar transport protein 122 homolog
Gene names
Organism names
- Organism
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Sarcopterygii > Dipnotetrapodomorpha > Tetrapoda (tetrapods) > Amniota (amniotes) > Mammalia (mammals) > Theria > Eutheria (placentals) > Boreoeutheria > Euarchontoglires > Primates > Haplorrhini > Simiiformes > Catarrhini > Hominoidea (apes) > Hominidae (great apes) > Homininae > Homo
Accessions
- Primary accessionA0A8I5KZ03
Proteomes
Organism-specific databases
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 251 variants from UniProt as well as other sources including ClinVar and dbSNP.
Genetic variation databases
PTM/Processing
Proteomic databases
Family & Domains
Features
Showing features for repeat, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 49-80 | WD | ||||
Sequence: LKGHKDTVYCVAYAKDGKRFASGSADKSVIIW | ||||||
Region | 220-249 | Disordered | ||||
Sequence: SAVYSSQGSEAEEEEPEEEDDSPRDDNLGT | ||||||
Compositional bias | 229-243 | Acidic residues | ||||
Sequence: EAEEEEPEEEDDSPR |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length249
- Mass (Da)27,821
- Last updated2022-05-25 v1
- Checksum050980D262EEF5D9
Computationally mapped potential isoform sequences
There are 59 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q9HBG6 | IF122_HUMAN | IFT122 | 1241 | ||
A0A8I5QJE0 | A0A8I5QJE0_HUMAN | IFT122 | 864 | ||
A0A8I5QKY6 | A0A8I5QKY6_HUMAN | IFT122 | 952 | ||
A0A8I5QKR8 | A0A8I5QKR8_HUMAN | IFT122 | 1112 | ||
A0A8I5QKV2 | A0A8I5QKV2_HUMAN | IFT122 | 1220 | ||
A0A8I5QKV6 | A0A8I5QKV6_HUMAN | IFT122 | 1129 | ||
A0A8I5QKX8 | A0A8I5QKX8_HUMAN | IFT122 | 1165 | ||
A0A8I5QL12 | A0A8I5QL12_HUMAN | IFT122 | 1010 | ||
A0A8I5QL25 | A0A8I5QL25_HUMAN | IFT122 | 1109 | ||
A0A8I5QJX4 | A0A8I5QJX4_HUMAN | IFT122 | 473 | ||
A0A8I5QKJ5 | A0A8I5QKJ5_HUMAN | IFT122 | 1127 | ||
A0A8J9A3C6 | A0A8J9A3C6_HUMAN | IFT122 | 1113 | ||
D6RIB5 | D6RIB5_HUMAN | IFT122 | 603 | ||
D6RAF7 | D6RAF7_HUMAN | IFT122 | 80 | ||
H0YAG6 | H0YAG6_HUMAN | IFT122 | 69 | ||
H0YAG9 | H0YAG9_HUMAN | IFT122 | 67 | ||
H0Y9Q2 | H0Y9Q2_HUMAN | IFT122 | 335 | ||
H0Y9I6 | H0Y9I6_HUMAN | IFT122 | 532 | ||
H0Y9Y9 | H0Y9Y9_HUMAN | IFT122 | 46 | ||
H0Y978 | H0Y978_HUMAN | IFT122 | 1076 | ||
A0A8C8L0T3 | A0A8C8L0T3_HUMAN | IFT122 | 140 | ||
A0A8I5KNX7 | A0A8I5KNX7_HUMAN | IFT122 | 880 | ||
A0A8I5KQ16 | A0A8I5KQ16_HUMAN | IFT122 | 1190 | ||
A0A8I5KQF6 | A0A8I5KQF6_HUMAN | IFT122 | 663 | ||
A0A8I5KP73 | A0A8I5KP73_HUMAN | IFT122 | 1233 | ||
A0A8I5KPB4 | A0A8I5KPB4_HUMAN | IFT122 | 977 | ||
A0A8I5KS77 | A0A8I5KS77_HUMAN | IFT122 | 1014 | ||
A0A8I5KS91 | A0A8I5KS91_HUMAN | IFT122 | 893 | ||
A0A8I5KRP5 | A0A8I5KRP5_HUMAN | IFT122 | 816 | ||
A0A8I5KSG5 | A0A8I5KSG5_HUMAN | IFT122 | 1242 | ||
A0A8I5KR03 | A0A8I5KR03_HUMAN | IFT122 | 604 | ||
A0A8I5KR07 | A0A8I5KR07_HUMAN | IFT122 | 764 | ||
A0A8I5KTT9 | A0A8I5KTT9_HUMAN | IFT122 | 621 | ||
A0A8I5KUK8 | A0A8I5KUK8_HUMAN | IFT122 | 399 | ||
A0A8I5KSN5 | A0A8I5KSN5_HUMAN | IFT122 | 1265 | ||
A0A8I5KSV0 | A0A8I5KSV0_HUMAN | IFT122 | 1163 | ||
A0A8I5KT04 | A0A8I5KT04_HUMAN | IFT122 | 1130 | ||
A0A8I5KT76 | A0A8I5KT76_HUMAN | IFT122 | 64 | ||
A0A8I5KT78 | A0A8I5KT78_HUMAN | IFT122 | 95 | ||
A0A8I5KSQ0 | A0A8I5KSQ0_HUMAN | IFT122 | 190 | ||
A0A8I5KTI2 | A0A8I5KTI2_HUMAN | IFT122 | 1018 | ||
A0A8I5KTL4 | A0A8I5KTL4_HUMAN | IFT122 | 1164 | ||
A0A8I5KX44 | A0A8I5KX44_HUMAN | IFT122 | 1128 | ||
A0A8I5KWK4 | A0A8I5KWK4_HUMAN | IFT122 | 1183 | ||
A0A8I5KX14 | A0A8I5KX14_HUMAN | IFT122 | 1145 | ||
A0A8I5KVC7 | A0A8I5KVC7_HUMAN | IFT122 | 1223 | ||
A0A8I5KUU2 | A0A8I5KUU2_HUMAN | IFT122 | 1189 | ||
A0A8I5KUV2 | A0A8I5KUV2_HUMAN | IFT122 | 567 | ||
A0A8I5KUY3 | A0A8I5KUY3_HUMAN | IFT122 | 953 | ||
A0A8I5KV39 | A0A8I5KV39_HUMAN | IFT122 | 263 | ||
A0A8I5KW25 | A0A8I5KW25_HUMAN | IFT122 | 976 | ||
A0A8I5KW32 | A0A8I5KW32_HUMAN | IFT122 | 862 | ||
A0A8I5KYB6 | A0A8I5KYB6_HUMAN | IFT122 | 1206 | ||
A0A8I5KYX1 | A0A8I5KYX1_HUMAN | IFT122 | 1133 | ||
A0A8I5KYR0 | A0A8I5KYR0_HUMAN | IFT122 | 79 | ||
A0A8I5KYT5 | A0A8I5KYT5_HUMAN | IFT122 | 1105 | ||
A0A8I5KXA7 | A0A8I5KXA7_HUMAN | IFT122 | 821 | ||
A0A8I5KXC8 | A0A8I5KXC8_HUMAN | IFT122 | 622 | ||
A0A8I5KXT5 | A0A8I5KXT5_HUMAN | IFT122 | 1224 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 229-243 | Acidic residues | ||||
Sequence: EAEEEEPEEEDDSPR |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC080007 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL449212 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |