A0A8I5KPV6 · A0A8I5KPV6_HUMAN
- ProteinMicrocephalin
- GeneMCPH1
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids871 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
function
Implicated in chromosome condensation and DNA damage induced cellular responses. May play a role in neurogenesis and regulation of the size of the cerebral cortex.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | centrosome | |
Cellular Component | nucleoplasm | |
Biological Process | cerebral cortex development |
Names & Taxonomy
Protein names
- Recommended nameMicrocephalin
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionA0A8I5KPV6
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,392 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue (large scale data) | 102 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 120 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 191 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 254 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 277 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 279 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 287 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 322 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 333 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 335 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 337 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 339 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 438 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 543 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 548 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 623 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Interaction
Subunit
Interacts with CDC27 and maybe other components of the APC/C complex. Interacts with histone variant H2AX under DNA damage conditions.
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-93 | BRCT | ||||
Sequence: MAAPILKDVVAYVEVWSSNGTENYSKTFTTQLVDMGAKVSKTFNKQVTHVIFKDGYQSTWDKAQKRGVKLVSVLWVEKCRTAGAHIDESLFPA | ||||||
Region | 313-381 | Disordered | ||||
Sequence: PDQKQAAGMSQETFEEKYRLSPTLSSTKGHLLIHSRPRSSSVKRKRVSHGSHSPPKEKCKRKRSTRRSI | ||||||
Compositional bias | 316-346 | Polar residues | ||||
Sequence: KQAAGMSQETFEEKYRLSPTLSSTKGHLLIH | ||||||
Compositional bias | 349-380 | Basic residues | ||||
Sequence: PRSSSVKRKRVSHGSHSPPKEKCKRKRSTRRS | ||||||
Region | 419-443 | Disordered | ||||
Sequence: DNLKERYSENLPPESQLPSSPAQLS | ||||||
Region | 555-584 | Disordered | ||||
Sequence: AVGLKSTQNKGTTSKISNSSEGEAQSEHEP | ||||||
Compositional bias | 559-579 | Polar residues | ||||
Sequence: KSTQNKGTTSKISNSSEGEAQ | ||||||
Domain | 672-730 | BRCT | ||||
Sequence: GFSIAPDVCETTTHVLSGKPLRTLNVLLGIARGCWVLSYDWVLWSLELGHWISEEPFEL |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length871
- Mass (Da)96,778
- Last updated2022-05-25 v1
- Checksum7BA9B01EB547E22A
Computationally mapped potential isoform sequences
There are 21 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q8NEM0 | MCPH1_HUMAN | MCPH1 | 835 | ||
A0A8I5QKY7 | A0A8I5QKY7_HUMAN | MCPH1 | 667 | ||
A0A8I5QKX9 | A0A8I5QKX9_HUMAN | MCPH1 | 506 | ||
A0A8I5QJK3 | A0A8I5QJK3_HUMAN | MCPH1 | 365 | ||
A0A8I5KRS3 | A0A8I5KRS3_HUMAN | MCPH1 | 46 | ||
A0A8I5KSF2 | A0A8I5KSF2_HUMAN | MCPH1 | 39 | ||
A0A8I5KQZ4 | A0A8I5KQZ4_HUMAN | MCPH1 | 100 | ||
A0A8I5KR97 | A0A8I5KR97_HUMAN | MCPH1 | 742 | ||
A0A8I5KR64 | A0A8I5KR64_HUMAN | MCPH1 | 608 | ||
A0A8I5KQQ3 | A0A8I5KQQ3_HUMAN | MCPH1 | 79 | ||
A0A8I5KRI7 | A0A8I5KRI7_HUMAN | MCPH1 | 580 | ||
A0A8I5KV10 | A0A8I5KV10_HUMAN | MCPH1 | 875 | ||
A0A8I5KTK9 | A0A8I5KTK9_HUMAN | MCPH1 | 57 | ||
A0A8I5KW78 | A0A8I5KW78_HUMAN | MCPH1 | 830 | ||
A0A8I5KX36 | A0A8I5KX36_HUMAN | MCPH1 | 890 | ||
A0A8I5KWR1 | A0A8I5KWR1_HUMAN | MCPH1 | 180 | ||
A0A8I5KYD2 | A0A8I5KYD2_HUMAN | MCPH1 | 166 | ||
A0A8I5KYX6 | A0A8I5KYX6_HUMAN | MCPH1 | 113 | ||
A0A8I5KZ89 | A0A8I5KZ89_HUMAN | MCPH1 | 744 | ||
A0A8I5KXP9 | A0A8I5KXP9_HUMAN | MCPH1 | 121 | ||
A0A8I5KXJ5 | A0A8I5KXJ5_HUMAN | MCPH1 | 450 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 316-346 | Polar residues | ||||
Sequence: KQAAGMSQETFEEKYRLSPTLSSTKGHLLIH | ||||||
Compositional bias | 349-380 | Basic residues | ||||
Sequence: PRSSSVKRKRVSHGSHSPPKEKCKRKRSTRRS | ||||||
Compositional bias | 559-579 | Polar residues | ||||
Sequence: KSTQNKGTTSKISNSSEGEAQ |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC016065 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC018398 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AF287957 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KC877206 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
KC877207 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |