A0A8I3Q679 · A0A8I3Q679_CANLF

Function

function

Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and eccrine sweat glands. Also plays a role in taste perception.

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentacrosomal vesicle
Cellular Componentapical plasma membrane
Cellular Componentciliary membrane
Cellular Componentcytosol
Cellular Componentexternal side of plasma membrane
Cellular Componentextracellular exosome
Cellular Componentmotile cilium
Cellular Componentsodium channel complex
Molecular Functionligand-gated sodium channel activity
Molecular FunctionWW domain binding
Biological Processcellular response to acidic pH
Biological Processcellular response to aldosterone
Biological Processintracellular sodium ion homeostasis
Biological Processmulticellular organismal-level water homeostasis
Biological Processsensory perception of taste
Biological Processsodium ion import across plasma membrane

Keywords

Enzyme and pathway databases

Names & Taxonomy

Protein names

  • Recommended name
    Amiloride-sensitive sodium channel subunit alpha
  • Alternative names
    • Alpha-NaCH
    • Epithelial Na(+) channel subunit alpha
    • Nonvoltage-gated sodium channel 1 subunit alpha
    • SCNEA

Gene names

    • Name
      SCNN1A

Organism names

  • Taxonomic identifier
  • Strain
    • Labrador retriever
  • Taxonomic lineage
    Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Carnivora > Caniformia > Canidae > Canis

Accessions

  • Primary accession
    A0A8I3Q679

Proteomes

Subcellular Location

Features

Showing features for transmembrane.

TypeIDPosition(s)Description
Transmembrane64-82Helical

Keywords

Interaction

Subunit

Heterotrimer containing an alpha/SCNN1A, a beta/SCNN1B and a gamma/SCNN1G subunit. An additional delta/SCNN1D subunit exists only in some organisms and can replace the alpha/SCNN1A subunit to form an alternative channel with specific properties. Interacts with NEDD4 (via WW domains). Interacts with NEDD4L (via WW domains). Interacts with WWP1 (via WW domains). Interacts with WWP2 (via WW domains). Interacts with the full-length immature form of PCSK9 (pro-PCSK9).

Family & Domains

Features

Showing features for region.

TypeIDPosition(s)Description
Region1-23Disordered
Region174-196Disordered

Sequence similarities

Keywords

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    649
  • Mass (Da)
    73,787
  • Last updated
    2022-05-25 v1
  • Checksum
    783FBA3F5F233643
MKGECREEEGLGPKPAAPQQPTEEEEALIEFHRSYRDLFQFFCNNTTIHGAIRLVCSKHNRMKTAFWAVLWLCAFIMMYWQFGQLFGEYFSYPVSLNINLNSDKLVFPAVTICTLNPYRYTQVKEELEELDRITEQTLYDLYKYNSSNTLGAHPRGRRDLREPWPHPLQRLRVPAPPSGARRARSAASSVQDNNPQVNRKDWKIGFQLCNQNKSDCFYQTYSSGVDAVREWYRFHYINILSRLPDTSLSSGEDMLDNFIFACRFNQASCNQANYSHFHHPMYGNCYTFNGKNNSNLWMSSMPGIKNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGMETSISMRKEALDRLGGNYGDCTKNGSEVPVENLYRSKYTQQVCIRSCFQENMIKQCGCAYIFYPLPKNAEFCDYRKHNSWGYCYYKLQDAFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQDWIFQMLSRQNNYTINNKRNGVAKLNIFFKELKYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELIFDLLVITFLMLLRRFRSRYWSPGRGGRGAQEVASTPASSFPSHFCPHSTSLSSSLPGPAISPALTAPPPAYATLGPCPSPFSLAGAHSSAYTLGKP

Computationally mapped potential isoform sequences

There is 1 potential isoform mapped to this entry

View all
EntryEntry nameGene nameLength
A0A8I3PZY3A0A8I3PZY3_CANLFSCNN1A494

Keywords

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp