A0A8F7F5W3 · A0A8F7F5W3_PIPNI
- ProteinRibulose bisphosphate carboxylase large chain
- GenerbcL
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids
- Protein existenceInferred from homology
- Annotation score2/5
Function
Catalytic activity
- 2 (2R)-3-phosphoglycerate + 2 H+ = CO2 + D-ribulose 1,5-bisphosphate + H2O
- D-ribulose 1,5-bisphosphate + O2 = (2R)-3-phosphoglycerate + 2-phosphoglycolate + 2 H+
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Molecular Function | monooxygenase activity | |
Molecular Function | ribulose-bisphosphate carboxylase activity | |
Biological Process | photorespiration | |
Biological Process | reductive pentose-phosphate cycle |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRibulose bisphosphate carboxylase large chain
- EC number
Gene names
Encoded on
- Chloroplast
Organism names
- Organism
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Magnoliidae > Piperales > Piperaceae > Piper
Accessions
- Primary accessionA0A8F7F5W3
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 6-91 | Ribulose bisphosphate carboxylase large subunit ferrodoxin-like N-terminal | ||||
Sequence: YYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGEENQYICYVAYPLDLFE |
Sequence similarities
Belongs to the RuBisCO large chain family. Type I subfamily.
Family and domain databases
Sequence
- Sequence statusFragment
- Length91
- Mass (Da)10,199
- Last updated2022-01-19 v1
- Checksum0A83950F5431DBD9
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: D | ||||||
Non-terminal residue | 91 | |||||
Sequence: E |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
MT465709 EMBL· GenBank· DDBJ | QXV24166.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT465710 EMBL· GenBank· DDBJ | QXV24167.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT465711 EMBL· GenBank· DDBJ | QXV24168.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT465713 EMBL· GenBank· DDBJ | QXV24169.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT465714 EMBL· GenBank· DDBJ | QXV24170.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT465715 EMBL· GenBank· DDBJ | QXV24171.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT465718 EMBL· GenBank· DDBJ | QXV24173.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT465720 EMBL· GenBank· DDBJ | QXV24174.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT465721 EMBL· GenBank· DDBJ | QXV24175.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT465723 EMBL· GenBank· DDBJ | QXV24177.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT465726 EMBL· GenBank· DDBJ | QXV24180.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT465727 EMBL· GenBank· DDBJ | QXV24181.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT465728 EMBL· GenBank· DDBJ | QXV24182.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT465729 EMBL· GenBank· DDBJ | QXV24183.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT465730 EMBL· GenBank· DDBJ | QXV24184.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT465731 EMBL· GenBank· DDBJ | QXV24185.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
MT465732 EMBL· GenBank· DDBJ | QXV24186.1 EMBL· GenBank· DDBJ | Genomic DNA |