A0A8E3Z158 · A0A8E3Z158_9INFA
- ProteinHemagglutinin
- GeneHA
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids567 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization either through clathrin-dependent endocytosis or through clathrin- and caveolin-independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 345-346 | Cleavage; by host | ||||
Sequence: RG |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell plasma membrane | |
Cellular Component | membrane | |
Cellular Component | viral envelope | |
Cellular Component | virion membrane | |
Molecular Function | host cell surface receptor binding | |
Biological Process | clathrin-dependent endocytosis of virus by host cell | |
Biological Process | fusion of virus membrane with host endosome membrane | |
Biological Process | fusion of virus membrane with host plasma membrane | |
Biological Process | viral budding from plasma membrane | |
Biological Process | virion attachment to host cell |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameHemagglutinin
- Cleaved into 2 chains
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Negarnaviricota > Polyploviricotina > Insthoviricetes > Articulavirales > Orthomyxoviridae > Alphainfluenzavirus > Alphainfluenzavirus influenzae
Accessions
- Primary accessionA0A8E3Z158
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Virion membrane ; Single-pass type I membrane protein
Host apical cell membrane ; Single-pass type I membrane protein
Note: Targeted to the apical plasma membrane in epithelial polarized cells through a signal present in the transmembrane domain. Associated with glycosphingolipid- and cholesterol-enriched detergent-resistant lipid rafts.
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 532-554 | Helical | ||||
Sequence: LSIYSTVASSLTLAIIVAGLSLW |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for disulfide bond, chain, lipidation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Disulfide bond | 58↔290 | |||||
Sequence: CDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERTNPANDLCYPGNLNDYEELKHLLSRINHFEKTLIIPKSSWPNHETSLGVSAACPYQGMPSFFRNVVWLTKKNDAYPTIKMSYNNTNREDLLILWGIHHPNNGAEQTSIYKNPTTYVSVGTSTLNQRLVPKIATRSQVNGQRGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKGDSTIMKSGIEYGYC | ||||||
Disulfide bond | 71↔83 | |||||
Sequence: CSVAGWLLGNPMC | ||||||
Disulfide bond | 106↔151 | |||||
Sequence: CYPGNLNDYEELKHLLSRINHFEKTLIIPKSSWPNHETSLGVSAAC | ||||||
Disulfide bond | 294↔318 | |||||
Sequence: CQTPIGAINSSMPFHNIHPLTIGEC | ||||||
Chain | PRO_5035346788 | 346-567 | Hemagglutinin HA2 chain | |||
Sequence: GLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADRESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYSEEARLKREEISGVKLESIGTYQILSIYSTVASSLTLAIIVAGLSLWMCSNGSLQCRICI | ||||||
Disulfide bond | 489↔493 | |||||
Sequence: CDNEC | ||||||
Lipidation | 556 | S-palmitoyl cysteine; by host | ||||
Sequence: C | ||||||
Lipidation | 563 | S-palmitoyl cysteine; by host | ||||
Sequence: C | ||||||
Lipidation | 566 | S-palmitoyl cysteine; by host | ||||
Sequence: C |
Post-translational modification
In natural infection, inactive HA is matured into HA1 and HA2 outside the cell by one or more trypsin-like, arginine-specific endoprotease secreted by the bronchial epithelial cells. One identified protease that may be involved in this process is secreted in lungs by club cells.
Palmitoylated.
Keywords
- PTM
Interaction
Subunit
Homotrimer of disulfide-linked HA1-HA2.
Structure
Family & Domains
Features
Showing features for coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 401-435 | |||||
Sequence: IDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLD |
Sequence similarities
Belongs to the influenza viruses hemagglutinin family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length567
- Mass (Da)64,258
- Last updated2022-01-19 v1
- ChecksumA6E76E66EF2FB562