A0A8D0HNA5 · A0A8D0HNA5_SPHPU

Function

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentcell body
Cellular Componentcytoplasmic ribonucleoprotein granule
Cellular Componentcytosolic small ribosomal subunit
Cellular Componentdendrite
Cellular Componentendoplasmic reticulum
Cellular Componentnucleolus
Cellular Componentperinuclear region of cytoplasm
Cellular Componentsmall-subunit processome
Molecular Functionprotein kinase binding
Molecular Functionstructural constituent of ribosome
Biological Processactivation-induced cell death of T cells
Biological Processcytoplasmic translation
Biological Processerythrocyte development
Biological ProcessG1/S transition of mitotic cell cycle
Biological Processgastrulation
Biological Processglucose homeostasis
Biological Processmammalian oogenesis stage
Biological Processnegative regulation of apoptotic process
Biological Processplacenta development
Biological Processpositive regulation of apoptotic process
Biological Processpositive regulation of cell population proliferation
Biological Processribosomal small subunit biogenesis
Biological ProcessrRNA processing
Biological ProcessT cell differentiation in thymus
Biological ProcessT cell proliferation involved in immune response
Biological ProcessTOR signaling

Keywords

Names & Taxonomy

Protein names

  • Recommended name
    40S ribosomal protein S6

Gene names

    • Name
      RPS6

Organism names

Accessions

  • Primary accession
    A0A8D0HNA5

Proteomes

Family & Domains

Features

Showing features for compositional bias, region.

Type
IDPosition(s)Description
Compositional bias217-233Basic and acidic residues
Region217-249Disordered

Sequence similarities

Belongs to the eukaryotic ribosomal protein eS6 family.

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    249
  • Mass (Da)
    28,700
  • Last updated
    2022-01-19 v1
  • Checksum
    DFD94C017A74F160
MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVSADSLGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKEIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYVVRKPLSKEGKKPRTKAPKIQRLVTPRVLQHKRRRIALKKQRTQKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK

Features

Showing features for compositional bias.

TypeIDPosition(s)Description
Compositional bias217-233Basic and acidic residues

Keywords

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp