A0A8C9ERV8 · A0A8C9ERV8_PAVCR
- ProteinAnnexin
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids834 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | focal adhesion | |
Cellular Component | mitochondrion | |
Molecular Function | actin filament binding | |
Molecular Function | calcium channel activity | |
Molecular Function | calcium ion binding | |
Molecular Function | calcium-dependent phospholipid binding | |
Molecular Function | cholesterol binding | |
Molecular Function | chondroitin sulfate binding | |
Molecular Function | GTP binding | |
Molecular Function | ligand-gated monoatomic ion channel activity | |
Molecular Function | phosphatidylserine binding | |
Biological Process | apoptotic signaling pathway | |
Biological Process | growth plate cartilage chondrocyte differentiation | |
Biological Process | mitochondrial calcium ion homeostasis | |
Biological Process | negative regulation of sequestering of calcium ion | |
Biological Process | neural crest cell migration | |
Biological Process | plasma membrane repair | |
Biological Process | regulation of muscle contraction |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameAnnexin
Organism names
- Taxonomic lineagecellular organisms > Eukaryota (eucaryotes) > Opisthokonta > Metazoa (metazoans) > Eumetazoa > Bilateria > Deuterostomia > Chordata (chordates) > Craniata > Vertebrata (vertebrates) > Gnathostomata (jawed vertebrates) > Teleostomi > Euteleostomi (bony vertebrates) > Sarcopterygii > Dipnotetrapodomorpha > Tetrapoda (tetrapods) > Amniota (amniotes) > Sauropsida (sauropsids) > Sauria (diapsids) > Archelosauria > Archosauria > Dinosauria > Saurischia > Theropoda > Coelurosauria > Aves (birds) > Neognathae > Galloanserae > Galliformes (landfowls) > Phasianidae (turkeys) > Phasianinae > Pavo (peafowls)
Accessions
- Primary accessionA0A8C9ERV8
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 33-102 | Disordered | ||||
Sequence: WQGRAASVTPHRTHPKSRGWGGEGGSAALTPKPRRAGIGAGSSDVVRREGTAAQQGRAHGHQYARSAPGC |
Domain
A pair of annexin repeats may form one binding site for calcium and phospholipid.
Sequence similarities
Belongs to the annexin family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length834
- Mass (Da)92,089
- Last updated2022-01-19 v1
- ChecksumC49C5B827AA4DECE
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8C9ERF8 | A0A8C9ERF8_PAVCR | 794 |
Keywords
- Technical term