A0A8C3PNV9 · A0A8C3PNV9_9CHAR
- Proteinaldehyde oxidase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids1294 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
Catalytic activity
- retinal + O2 + H2O = retinoate + H2O2 + H+
Cofactor
Protein has several cofactor binding sites:
Note: Binds 1 Mo-molybdopterin (Mo-MPT) cofactor per subunit.
Note: Binds 2 [2Fe-2S] clusters.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 15 | [2Fe-2S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 20 | [2Fe-2S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 23 | [2Fe-2S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 45 | [2Fe-2S] cluster 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 85 | [2Fe-2S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 88 | [2Fe-2S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 120 | [2Fe-2S] cluster 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 225-232 | FAD (UniProtKB | ChEBI) | ||||
Sequence: LVVGNTSV | ||||||
Binding site | 314-318 | FAD (UniProtKB | ChEBI) | ||||
Sequence: SLGGN | ||||||
Binding site | 327 | FAD (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 371 | FAD (UniProtKB | ChEBI) | ||||
Sequence: L | ||||||
Binding site | 389 | FAD (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 735 | Mo (UniProtKB | ChEBI) of Mo-molybdopterin (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 766 | Mo (UniProtKB | ChEBI) of Mo-molybdopterin (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 880 | Mo (UniProtKB | ChEBI) of Mo-molybdopterin (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 882 | substrate | ||||
Sequence: F | ||||||
Binding site | 1047 | Mo (UniProtKB | ChEBI) of Mo-molybdopterin (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Active site | 1229 | Proton acceptor | ||||
Sequence: E |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | 2 iron, 2 sulfur cluster binding | |
Molecular Function | aldehyde oxidase activity | |
Molecular Function | FAD binding | |
Molecular Function | iron ion binding | |
Molecular Function | NAD binding | |
Biological Process | lipid metabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namealdehyde oxidase
- EC number
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Archosauria > Dinosauria > Saurischia > Theropoda > Coelurosauria > Aves > Neognathae > Neoaves > Charadriiformes > Scolopacidae > Calidris
Accessions
- Primary accessionA0A8C3PNV9
Proteomes
Subcellular Location
Interaction
Subunit
Homodimer.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-63 | 2Fe-2S ferredoxin-type | ||||
Sequence: MTAFSVRLTGTKYGCGGGGCGACTVMISTYEPTSKKIRHYSANACLLPICSLYGAAVTTVEGV | ||||||
Domain | 197-381 | FAD-binding PCMH-type | ||||
Sequence: FCGERMTWISPVSLDELLDLKAAHPKAPLVVGNTSVGPEMKFRGVFHPIVIAPARILDLNVVTHMDDGLTLGAACSLSLVKDILTNAISEFPEEKTKVFCAVLQQLRTLGGEQIRNVSLGGNIISRKSTSDLNPVLAASNCVLNLASKGRKRQIPLSDIFADGVGNNTITSEEILVSVHIPHSRK |
Sequence similarities
Belongs to the xanthine dehydrogenase family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,294
- Mass (Da)141,829
- Last updated2022-01-19 v1
- Checksum0C4D861474AB0A02
Computationally mapped potential isoform sequences
There are 9 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8C3K1Z6 | A0A8C3K1Z6_9CHAR | 1308 | |||
A0A8C3JY10 | A0A8C3JY10_9CHAR | 1301 | |||
A0A8C3JX91 | A0A8C3JX91_9CHAR | 1297 | |||
A0A8C3JYC6 | A0A8C3JYC6_9CHAR | 1295 | |||
A0A8C3K5B8 | A0A8C3K5B8_9CHAR | 1303 | |||
A0A8C3K0M0 | A0A8C3K0M0_9CHAR | 1296 | |||
A0A8C3K206 | A0A8C3K206_9CHAR | 1302 | |||
A0A8C3PNG8 | A0A8C3PNG8_9CHAR | 1304 | |||
A0A8C3JZD3 | A0A8C3JZD3_9CHAR | 1295 |
Keywords
- Technical term