A0A8B8USL1 · A0A8B8USL1_SACPA

Function

Features

Showing features for binding site, site.

144650100150200250300350400
TypeIDPosition(s)Description
Binding site251L-serine (UniProtKB | ChEBI)
Binding site284L-serine (UniProtKB | ChEBI)
Binding site284-286ATP (UniProtKB | ChEBI)
Binding site300-303ATP (UniProtKB | ChEBI)
Binding site307L-serine (UniProtKB | ChEBI)
Binding site371-374ATP (UniProtKB | ChEBI)
Binding site405L-serine (UniProtKB | ChEBI)
Site407Important for serine binding

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentmitochondrion
Molecular FunctionATP binding
Molecular Functionserine-tRNA ligase activity
Molecular FunctiontRNA binding
Biological Processmitochondrial seryl-tRNA aminoacylation

Keywords

Enzyme and pathway databases

Names & Taxonomy

Protein names

  • Recommended name
    serine--tRNA ligase
  • EC number
  • Alternative names
    • Seryl-tRNA synthetase
    • Seryl-tRNA(Ser) synthetase

Gene names

    • ORF names
      SPAR_H00530

Organism names

Accessions

  • Primary accession
    A0A8B8USL1

Organism-specific databases

Subcellular Location

Family & Domains

Features

Showing features for coiled coil, domain.

TypeIDPosition(s)Description
Coiled coil62-117
Domain156-433Aminoacyl-transfer RNA synthetases class-II family profile

Keywords

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    446
  • Mass (Da)
    50,372
  • Last updated
    2022-01-19 v1
  • Checksum
    CD5CBF0C22C3C694
MIIRRLFSMSNCSFFLKKPQFDVKRIIEMIPQYEKSIQNRELIKADSIIRSLKLLSEQYQNIKEIDKAIADIQIQRKSIEARIKKDRTEIAEYSAALKALKEQYQDQDSKLLELKNKISETCKSLPNILDPTVPLGAPQIEQWINPLEAYKTSEAQAHVGIMLKKNMLDLQTASNIAGMSWYYLLNDGARLEQALVAYALKKANENGFASCTPPSITKKELIDACGFNPRDMNNERQIYTLQDTNLGLVATAEISMAGLGANKVLDLNSAECSKKLVGVSRCYRAEAGARGRDTKGLYRVHEFTKVELFCWSKPEISAKILEEIKQFQISVVKELGLPAKVLNMPSNDLGNPAFKKYDIEAWMPGRGNFGEISSASNCTDFQSRRLNTKYKDDSTGKLKYVHTLNGTAMAIPRMMVALVENFYDPSTGKISVPECLREFMNGQRYI

Sequence databases

Genome annotation databases

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp